DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon44E and CG10764

DIOPT Version :9

Sequence 1:NP_001286203.1 Gene:Jon44E / 35853 FlyBaseID:FBgn0001285 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_611213.2 Gene:CG10764 / 36962 FlyBaseID:FBgn0034221 Length:523 Species:Drosophila melanogaster


Alignment Length:283 Identity:81/283 - (28%)
Similarity:129/283 - (45%) Gaps:43/283 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLFVFLACLAVASAGVVPSESARAVPVKDMPRAGKIEGRITNGYPAYEGKIPYIVGLSFNDGGY 65
            |:..|.:|.|::.:..|..:|..:.:   :.|.......:|:.|..|.|....::..: ||...:
  Fly     1 MRSLVSVALLSLLTLCVTENEHFKFL---ETPCGISTRPKISGGDDAAEPNSIWMAAI-FNSSDF 61

  Fly    66 WCGGSIIDHTWVLTAAHCTNSANHVLIYFGASFRHEAQYTHWVSRSDMIQHPDWNDFL----NND 126
            .|||:||...:||:||||......:.:..||...:|....|.|  .::..|   :||:    .||
  Fly    62 QCGGTIIHMRFVLSAAHCLVRGYDLYVRLGARNINEPAAVHTV--INVFVH---HDFIASEYRND 121

  Fly   127 IALIRIPHVDFWSLVNKVEL--------PSYNDRYNSYSGWWAVASGWGLTDNNSGMSNYLNCVD 183
            |.|:::..    |:|..|.:        |:..........:.|:  |||  :.|..:|..|..:.
  Fly   122 IGLLQLSE----SIVYTVRVQPICIFLDPALKGSVEKLKTFRAL--GWG--NRNGKLSIMLQTIY 178

  Fly   184 VQIIDNNDCRNYYGSNYITDNTICINTDGGKSSCSGDSGGPL---VLHDNNRI----VGIVSFGS 241
            :..:..|:|:.....| :....||..|..| .:|.|||||||   :|..:|:.    :||||||.
  Fly   179 LLHLKRNECKRKLNFN-LNSRQICAGTKNG-DTCRGDSGGPLSTNILFPSNKSYEVQLGIVSFGD 241

  Fly   242 GEGCTAGRPAG-FTRVTGYLDWI 263
            .| |   |..| :|.||.|:|||
  Fly   242 PE-C---RGVGVYTDVTSYVDWI 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon44ENP_001286203.1 Tryp_SPc 40..263 CDD:214473 72/242 (30%)
Tryp_SPc 41..266 CDD:238113 74/243 (30%)
CG10764NP_611213.2 Tryp_SPc 37..260 CDD:214473 72/242 (30%)
Tryp_SPc 38..263 CDD:238113 74/243 (30%)
Tryp_SPc 317..512 CDD:214473
Tryp_SPc 317..512 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435684
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.