DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon44E and Ctrc

DIOPT Version :9

Sequence 1:NP_001286203.1 Gene:Jon44E / 35853 FlyBaseID:FBgn0001285 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001071117.1 Gene:Ctrc / 362653 RGDID:1308379 Length:268 Species:Rattus norvegicus


Alignment Length:277 Identity:85/277 - (30%)
Similarity:118/277 - (42%) Gaps:34/277 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VFLACLAVASAGVVPSESARAVPVKDMPRAGKIEGRITNGYPAYEGKIPYIVGLSFNDGGYW--- 66
            |..|.||.||....|     |.|       ..:..|:..|..|.....|:.|.|.:.....|   
  Rat     6 VLAAILACASCCGNP-----AFP-------PNLSTRVVGGEDAVPNSWPWQVSLQYLKDDTWRHT 58

  Fly    67 CGGSIIDHTWVLTAAHCTNSANHVLIYFGA-SFRHEAQYTHWVSRSDMIQ-HPDWND-FLNNDIA 128
            ||||:|..:.|||||||.|......:..|. :...|.:.....:..|.|. |..||. ||.||||
  Rat    59 CGGSLITTSHVLTAAHCINKDFTYRVGLGKYNLTVEDEEGSVYAEVDTIYVHEKWNRLFLWNDIA 123

  Fly   129 LIRIPH-VDFWSLVNKVELPSYN----DRYNSYSGWWAVASGWGLTDNNSGMSNYLNCVDVQIID 188
            :|::.. |:..:.:....:|...    ..|..|      .:|||....|..::..|......|:.
  Rat   124 IIKLAEPVELSNTIQVACIPEEGSLLPQDYPCY------VTGWGRLWTNGPIAEVLQQGLQPIVS 182

  Fly   189 NNDC-RNYYGSNYITDNTICINTDGGKSSCSGDSGGPLVLHDNN---RIVGIVSFGSGEGCTA-G 248
            :..| |..:....:....:|...||..|:|:|||||||.....:   ::.|||||||..||.. .
  Rat   183 HATCSRLDWWFIKVRKTMVCAGGDGVISACNGDSGGPLNCQAEDGSWQVHGIVSFGSSSGCNVHK 247

  Fly   249 RPAGFTRVTGYLDWIRD 265
            :|..||||:.|.|||.:
  Rat   248 KPVVFTRVSAYNDWINE 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon44ENP_001286203.1 Tryp_SPc 40..263 CDD:214473 74/238 (31%)
Tryp_SPc 41..266 CDD:238113 75/241 (31%)
CtrcNP_001071117.1 Tryp_SPc 29..262 CDD:214473 74/238 (31%)
Tryp_SPc 30..265 CDD:238113 75/241 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBU3
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 143 1.000 Inparanoid score I4367
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.860

Return to query results.
Submit another query.