DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon44E and PRSS41

DIOPT Version :9

Sequence 1:NP_001286203.1 Gene:Jon44E / 35853 FlyBaseID:FBgn0001285 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001382429.1 Gene:PRSS41 / 360226 HGNCID:30715 Length:334 Species:Homo sapiens


Alignment Length:273 Identity:80/273 - (29%)
Similarity:122/273 - (44%) Gaps:39/273 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 PSESARAVPVKDMPRAGKIEGRITNGYPAYEGKIPYIVGLSFNDGGYWCGGSIIDHTWVLTAAHC 83
            |:||.....:.:.....:|...:..|..:..|:.|:...|... ..:.||||::...|||:||||
Human    49 PAESQEEELLSEACGHREIHALVAGGVESARGRWPWQASLRLR-RRHRCGGSLLSRRWVLSAAHC 112

  Fly    84 TNSANHVLIYFGASFRHE-----AQYTHWVSRS--------DMIQHPDWNDFLNNDIALIRI-PH 134
            ..  .|   |:.:.:..:     ::.|.|..|:        |:|.:||....|.|||||:|: ..
Human   113 FQ--KH---YYPSEWTVQLGELTSRPTPWNLRAYSSRYKVQDIIVNPDALGVLRNDIALLRLASS 172

  Fly   135 VDFWSLVNKVELPSYNDRYNSYSGWWAVASGWGLTDNNSGM----SNYLNCVDVQIIDNNDCRNY 195
            |.:.:.:..:.:.|....:......|  .:||||. :.||.    ...|....|.|::|..| ||
Human   173 VTYNAYIQPICIESSTFNFVHRPDCW--VTGWGLI-SPSGTPLPPPYNLREAQVTILNNTRC-NY 233

  Fly   196 Y-----GSNYITDNTICINT-DGGKSSCSGDSGGPLVLHDNNRI---VGIVSFGSGEGCTAGRPA 251
            .     ..:.|.|:..|... ||...:|.||||||||. |.:.:   |||||:|...| ...||.
Human   234 LFEQPSSRSMIWDSMFCAGAEDGSVDTCKGDSGGPLVC-DKDGLWYQVGIVSWGMDCG-QPNRPG 296

  Fly   252 GFTRVTGYLDWIR 264
            .:|.::.|..|||
Human   297 VYTNISVYFHWIR 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon44ENP_001286203.1 Tryp_SPc 40..263 CDD:214473 73/249 (29%)
Tryp_SPc 41..266 CDD:238113 76/251 (30%)
PRSS41NP_001382429.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.