DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon44E and CG17572

DIOPT Version :9

Sequence 1:NP_001286203.1 Gene:Jon44E / 35853 FlyBaseID:FBgn0001285 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_609941.2 Gene:CG17572 / 35182 FlyBaseID:FBgn0032753 Length:385 Species:Drosophila melanogaster


Alignment Length:315 Identity:79/315 - (25%)
Similarity:119/315 - (37%) Gaps:97/315 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 SAGVVPSESARAVPVKDMPRAGK--IEGRITNGYPAYEGKIPYIVGLSF---NDG--GYWCGGSI 71
            |:..:|.....:.|::.....||  ::|....|..:|    |::..:.|   |.|  .|.|.|::
  Fly   104 SSEELPYVCCPSSPLEKNQVCGKSLVQGHFYKGLGSY----PFVARIGFKHVNTGAFAYPCAGAV 164

  Fly    72 IDHTWVLTAAHCT---------------------------------NSANHVLIYFGASFRHEAQ 103
            |....:||||||.                                 .|.||.:            
  Fly   165 IARRVILTAAHCALAKADGHRLSSVRVGEYDTSSDPDCANTGFCAPRSVNHAI------------ 217

  Fly   104 YTHWVSRSDMIQHPDWND-FLNNDIALIRIPHVDFWSLVNKVELPSYN----------DRYNSYS 157
                   |.:|.|||:.. ..::||||          ||.|..| :|:          .|.|...
  Fly   218 -------SHVIVHPDYKQGQYHHDIAL----------LVLKTPL-NYSVATQPICLQKTRANLVV 264

  Fly   158 GWWAVASGWGLTDNNSGMSNYLNCVDVQIIDNNDCRNYYGS-------NYITDNTICINTDGGKS 215
            |..|..:|||....:|.....::.:||.:...:.|...|||       |.|....:|...: ||.
  Fly   265 GKRATIAGWGKMSTSSVRQPEMSHLDVPLTSWDLCLRNYGSTGALESPNSIEGQWMCAGGE-GKD 328

  Fly   216 SCSGDSGGPLVLHDNNRI--VGIVSFGSGEGCTAGR-PAGFTRVTGYLDWIRDHT 267
            .|.|..|.||.:.:|...  :||:|||| :.|...| |:.:|.|..:.:||.|:|
  Fly   329 VCQGFGGAPLFIQENGIFSQIGIMSFGS-DNCGGLRIPSVYTSVAHFSEWIHDNT 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon44ENP_001286203.1 Tryp_SPc 40..263 CDD:214473 69/281 (25%)
Tryp_SPc 41..266 CDD:238113 71/283 (25%)
CG17572NP_609941.2 Tryp_SPc 138..381 CDD:238113 70/278 (25%)
Tryp_SPc 138..378 CDD:214473 68/275 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.