DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon44E and CG4650

DIOPT Version :9

Sequence 1:NP_001286203.1 Gene:Jon44E / 35853 FlyBaseID:FBgn0001285 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_609722.2 Gene:CG4650 / 34859 FlyBaseID:FBgn0032549 Length:299 Species:Drosophila melanogaster


Alignment Length:248 Identity:61/248 - (24%)
Similarity:103/248 - (41%) Gaps:41/248 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 GRITNGYPAYEGKIPYIVGLSFNDGGYWCGGSIIDHTWVLTAAHCTNSANHVLI----YFGASFR 99
            |.:|||..|.....|::..|..::..|.|||::|....||||||||.::..::.    :.|....
  Fly    29 GLLTNGKIANNISSPWMAYLHTSELLYVCGGTVITEKLVLTAAHCTRASEQLVARIGEFIGTDDA 93

  Fly   100 HEAQYTHWVSRSDMIQHPDWNDFLN-NDIAL------------IRIPHVDFWSLVNKVELPSYND 151
            ::...:.:......| |..:|...: ||||:            ||...:.:|::..|     |.|
  Fly    94 NDTMLSEYQVSQTFI-HSLYNTTTSANDIAILGLATDIVFSKTIRPICIVWWTIWRK-----YID 152

  Fly   152 RYNSYSGWWAVASGWGLTDNNSGMSNYLNCVDVQIIDNNDCRNYYGSNYITDNTICINTDGGKSS 216
            .....||     :.||| .|:...|:.....|::....|.|....|: .|..:..|.. |.....
  Fly   153 NIQVLSG-----AQWGL-PNDRNESDAFRITDIRRQPANMCSTLNGT-AILSSQFCAG-DSDSKL 209

  Fly   217 CSGDSGGPL---VLHDNNR---IVGIVSFGSGEGCTAGRPAGFTRVTGYLDWI 263
            |:.|...||   :...|.:   ::||.:  :.:.|.  |.:.:|.|..:.|:|
  Fly   210 CNVDFSSPLGAIITFKNIQRYVLIGIAT--TNQKCK--RASVYTDVLSHTDFI 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon44ENP_001286203.1 Tryp_SPc 40..263 CDD:214473 59/245 (24%)
Tryp_SPc 41..266 CDD:238113 60/246 (24%)
CG4650NP_609722.2 Tryp_SPc 33..258 CDD:214473 58/242 (24%)
Tryp_SPc 33..258 CDD:304450 58/242 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435671
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.