DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon44E and ela2l

DIOPT Version :9

Sequence 1:NP_001286203.1 Gene:Jon44E / 35853 FlyBaseID:FBgn0001285 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_956180.1 Gene:ela2l / 334304 ZFINID:ZDB-GENE-040511-1 Length:267 Species:Danio rerio


Alignment Length:279 Identity:90/279 - (32%)
Similarity:129/279 - (46%) Gaps:35/279 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLFVFLACLAVA--SAGVVPSESARAVPVKDMPRAGKIEGRITNGYPAYEGKIPYIVGLSFNDG 63
            |..||.||.|.|.  |.|              :|....|..|:..|........|:.:.|.:..|
Zfish     1 MMKFVVLAVLVVGAYSCG--------------LPTFPPIVTRVVGGVDVRPNSWPWQISLQYKSG 51

  Fly    64 GYW---CGGSIIDHTWVLTAAHCTNSANHVLIYFGA-SFRHEAQYTHWVSRSDMIQHPDWNDF-L 123
            ..|   ||||:||..||||||||.:|:....::.|. |...|...:..:....:|.|..||.| :
Zfish    52 SNWYHTCGGSLIDKQWVLTAAHCISSSRTYRVFLGKHSLSQEENGSVAIGAGKIIVHEAWNSFTI 116

  Fly   124 NNDIALIRI-PHVDFWSLVNKVELP--SYNDRYNSYSGWWAVASGWGLTDNNSGMSNYLNCVDVQ 185
            .||||||:: ..|.....:....||  .|...:|:.    ...:|||....|..:::.|....:.
Zfish   117 RNDIALIKLETAVTIGDTITPACLPEAGYVLPHNAP----CYVTGWGRLYTNGPLADILQQALLP 177

  Fly   186 IIDNNDC--RNYYGSNYITDNTICINTDGGKSSCSGDSGGPLVLHDNN---RIVGIVSFGSGEGC 245
            ::|:..|  .:::||. :|.:.:|...||..:.|.|||||||....::   .:.||||||||..|
Zfish   178 VVDHATCSKSDWWGSQ-VTTSMVCAGGDGVVAGCDGDSGGPLNCAGSDGAWEVHGIVSFGSGLSC 241

  Fly   246 TAG-RPAGFTRVTGYLDWI 263
            ... :|..||||:.|.|||
Zfish   242 NYNKKPTVFTRVSAYSDWI 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon44ENP_001286203.1 Tryp_SPc 40..263 CDD:214473 77/236 (33%)
Tryp_SPc 41..266 CDD:238113 78/237 (33%)
ela2lNP_956180.1 Tryp_SPc 28..260 CDD:214473 77/236 (33%)
Tryp_SPc 29..263 CDD:238113 78/237 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 154 1.000 Domainoid score I4208
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 156 1.000 Inparanoid score I4253
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm24991
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.