DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon44E and sphe

DIOPT Version :9

Sequence 1:NP_001286203.1 Gene:Jon44E / 35853 FlyBaseID:FBgn0001285 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_573148.2 Gene:sphe / 32648 FlyBaseID:FBgn0030774 Length:249 Species:Drosophila melanogaster


Alignment Length:248 Identity:63/248 - (25%)
Similarity:111/248 - (44%) Gaps:44/248 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 EGRITNGYPAYEGKIPYIVGLSFNDGGYWCGGSIIDHTWVLTAAHCTN------SANHVLIYFGA 96
            :|||..|..|......:...|.. |..:.|||||:..|.:||.|||.:      .|:.:....|:
  Fly    23 QGRIMGGEDADATATTFTASLRV-DNAHVCGGSILSQTKILTTAHCVHRDGKLIDASRLACRVGS 86

  Fly    97 SFRHEAQYT--HWVSRSDMIQHPDWNDFLNNDIALIRIPHVDFWSLVNKVELPSYNDRYNSY--- 156
            :    .||.  ..|:...:..|||:.: |||::|:|.:          ..|| :|.||..:.   
  Fly    87 T----NQYAGGKIVNVESVAVHPDYYN-LNNNLAVITL----------SSEL-TYTDRITAIPLV 135

  Fly   157 --------SGWWAVASGWGLTDNNSGMSNY-LNCVDVQIIDNNDCRNYYGSNYITDNTICINTDG 212
                    .|...:.:|||.|  :.|.::| :..:.:::.....|.:.|..:  .:.:.|:..:.
  Fly   136 ASGEALPAEGSEVIVAGWGRT--SDGTNSYKIRQISLKVAPEATCLDAYSDH--DEQSFCLAHEL 196

  Fly   213 GKSSCSGDSGGPLVLHDNNRIVGIVSFGSGEGCTAGRPAGFTRVTGYLDWIRD 265
            .:.:|.||.||..:.  .|.::|:.:|..| .|.:..|..|.|::.|.|||::
  Fly   197 KEGTCHGDGGGGAIY--GNTLIGLTNFVVG-ACGSRYPDVFVRLSSYADWIQE 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon44ENP_001286203.1 Tryp_SPc 40..263 CDD:214473 60/242 (25%)
Tryp_SPc 41..266 CDD:238113 61/245 (25%)
spheNP_573148.2 Tryp_SPc 42..247 CDD:238113 58/229 (25%)
Tryp_SPc 42..244 CDD:214473 56/225 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471083
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.