DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon44E and ctrb.1

DIOPT Version :9

Sequence 1:NP_001286203.1 Gene:Jon44E / 35853 FlyBaseID:FBgn0001285 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_997783.1 Gene:ctrb.1 / 322451 ZFINID:ZDB-GENE-030131-1171 Length:263 Species:Danio rerio


Alignment Length:281 Identity:107/281 - (38%)
Similarity:141/281 - (50%) Gaps:36/281 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLFVFLACLAVASAGVVPSESARAVPVKDMPRAGKIEGRITNGYPAYEGKIPYIVGLSFNDGGY 65
            |.....|:|||...|       |....:..:|.......||.||..|.....|:.|.|..:.|.:
Zfish     1 MAFLWILSCLAFFGA-------AYGCGIPAIPPVVTGYARIVNGEEARPHSWPWQVSLQDSTGFH 58

  Fly    66 WCGGSIIDHTWVLTAAHCTNSANH--VLIYFGASFRHEAQYTHWVSRSDMIQHPDWNDF-LNNDI 127
            :||||:|:..||:|||||....:|  :|.....|...||..|..|.:|  |:||::|.| :||||
Zfish    59 FCGGSLINENWVVTAAHCNVRTSHRVILGEHDRSSNAEAIQTIAVGKS--IKHPNYNSFTINNDI 121

  Fly   128 ALIRI-------PHVDFWSLVNKVELPSYNDRYNSYSGWWAVASGWGLTDNNS-GMSNYLNCVDV 184
            .||::       .|      |:.|.|...||  |...|...|.||||||..|: .....|....:
Zfish   122 LLIKLATPAKINTH------VSPVCLAETND--NFPGGMKCVTSGWGLTRYNAPDTPALLQQAAL 178

  Fly   185 QIIDNNDCRNYYGSNYITDNTICINTDGGKSSCSGDSGGPLVLHDNNRI---VGIVSFGSGEGCT 246
            .::.|:||:.|:|:| |||..||... .|.|||.||||||||. :|||:   |||||:||.. |:
Zfish   179 PLLTNDDCKRYWGTN-ITDLMICAGA-SGVSSCMGDSGGPLVC-ENNRVWTLVGIVSWGSST-CS 239

  Fly   247 AGRPAGFTRVTGYLDWIRDHT 267
            ...||.:.|||....|: |.|
Zfish   240 TSTPAVYARVTKLRAWV-DQT 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon44ENP_001286203.1 Tryp_SPc 40..263 CDD:214473 96/236 (41%)
Tryp_SPc 41..266 CDD:238113 96/238 (40%)
ctrb.1NP_997783.1 Tryp_SPc 33..256 CDD:214473 96/236 (41%)
Tryp_SPc 34..259 CDD:238113 97/239 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.