DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon44E and CG31205

DIOPT Version :9

Sequence 1:NP_001286203.1 Gene:Jon44E / 35853 FlyBaseID:FBgn0001285 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001287432.1 Gene:CG31205 / 318626 FlyBaseID:FBgn0051205 Length:274 Species:Drosophila melanogaster


Alignment Length:240 Identity:62/240 - (25%)
Similarity:96/240 - (40%) Gaps:59/240 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 IVGLSFNDGG--YWCGGSIIDHTWVLTAAHCTNSANHVLIY---FGASFRHEAQYTHWVSRSDMI 114
            |||:: .||.  ..|.|.:||...|:|||||.:......||   ||.|   ::...:.||.  :.
  Fly    55 IVGVT-KDGSNTLLCTGILIDSRRVVTAAHCVSKDESESIYGVVFGDS---DSSNINLVSA--VT 113

  Fly   115 QHPDWND-FLNNDIALIRI-PHVDFWSLVNKVELPSYNDRYNSYSGWWAVASGWGLTDNNSGM-- 175
            .|||::. ...||:|:|.: ..|.|..||..:.|||.::...            |...:||.:  
  Fly   114 VHPDYSPRKFENDLAIIELTKEVVFSDLVQPICLPSVSEMVP------------GSETSNSKLIV 166

  Fly   176 -----------SNYLNCVDVQI------IDNNDCRNYYGSNYITDNTICINTDGGKSSCSGD--- 220
                       .:....:|.:|      ||:.:|......  ..:..||.:|:  :|..||.   
  Fly   167 AGLEGPSFDRRHSATQRLDKRIKMTYTKIDSKECHEKQAR--FPEELICGHTE--RSPLSGSALT 227

  Fly   221 --SGGPLVLHDNNRIVGIVSFGSGEGCTAGRPAGFTRVTGYLDWI 263
              ||.|...|    ::||...|........:  |:..:..:||||
  Fly   228 EASGTPRQFH----LLGIAVAGFFSSDLDHQ--GYLNIRPHLDWI 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon44ENP_001286203.1 Tryp_SPc 40..263 CDD:214473 60/238 (25%)
Tryp_SPc 41..266 CDD:238113 62/240 (26%)
CG31205NP_001287432.1 Tryp_SPc 44..>168 CDD:304450 39/130 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.