DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon44E and sphinx1

DIOPT Version :9

Sequence 1:NP_001286203.1 Gene:Jon44E / 35853 FlyBaseID:FBgn0001285 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_729255.2 Gene:sphinx1 / 318005 FlyBaseID:FBgn0052383 Length:253 Species:Drosophila melanogaster


Alignment Length:294 Identity:80/294 - (27%)
Similarity:132/294 - (44%) Gaps:68/294 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLFVFLACLAV-ASAGVVPSESARAVPVKDMPRAGKIEGRITNGYPAYEGKIPYIVGL------ 58
            |||.|.|..|:: .|.|                ...|:..||..||.|....|.|:||:      
  Fly     1 MKLVVTLLVLSLTVSVG----------------EKNKLSPRIAGGYRAKTFTIIYLVGIVYFKSQ 49

  Fly    59 --SFNDGGYWCGGSIIDHTWVLTAAHCTNSANHVLIYFGASFRHEAQY--THWVSRS-----DMI 114
              |.|.|    .|:||.:.|:||       ...||.|         .|  .|..||.     |:|
  Fly    50 TSSLNYG----AGTIISNQWILT-------VKTVLKY---------SYIEVHLASRRSYRGFDII 94

  Fly   115 Q--------HPDWNDFLNNDIALIRIPHVDFWSLVNKVELPSYNDRYNSYSGWWAVASGWGLTDN 171
            :        |.| ||.:   |||::.|:..|...:::|.:|:|:.|:..|.|...:..|:|....
  Fly    95 RIYKENFRFHYD-NDHV---IALVKCPYQKFDRRMDRVRVPAYDTRFERYVGNMTMVCGYGTEKR 155

  Fly   172 NSGMSNYLNCVDVQIIDNNDCRNYYGSNYITDNTICINTDGGKSSCSGDSGGPLV-LHDNNRIVG 235
            ::.:..::.|::|::::|.:|..||  ..:....:|.:.:|.|..|.||.||.:| :..|...:|
  Fly   156 HAKLPEWMRCIEVEVMNNTECAKYY--TPLKWYEMCTSGEGFKGVCEGDIGGAVVTMGPNPTFIG 218

  Fly   236 IVSFGSGEGCTAGRPAGFTRVTGYLDWIRDHTGI 269
            |: :...|.|:.|.|:...||:.::.||:..:|:
  Fly   219 II-WLMPENCSIGYPSVHIRVSDHIKWIKRVSGV 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon44ENP_001286203.1 Tryp_SPc 40..263 CDD:214473 68/246 (28%)
Tryp_SPc 41..266 CDD:238113 69/248 (28%)
sphinx1NP_729255.2 Tryp_SPc 25..245 CDD:214473 68/246 (28%)
Tryp_SPc 26..248 CDD:304450 69/248 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471022
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H134616
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D101263at6656
OrthoFinder 1 1.000 - - FOG0000557
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.