DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon44E and spirit

DIOPT Version :9

Sequence 1:NP_001286203.1 Gene:Jon44E / 35853 FlyBaseID:FBgn0001285 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001162707.1 Gene:spirit / 31797 FlyBaseID:FBgn0030051 Length:393 Species:Drosophila melanogaster


Alignment Length:299 Identity:79/299 - (26%)
Similarity:133/299 - (44%) Gaps:54/299 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FVFLACLAVASAGVVPSESARAVPVKDMPRAGKIEG------RITNGYPAYEGKIPYIVGLSFND 62
            |....|.|.|.|.:|...|.:|  ..::.:..|::.      .:..|.|....:.|::..|.:..
  Fly    91 FDHYVCCAPAVAPIVTRSSQQA--CNELNKVSKVKEIDEFFVSVVGGMPTRPREFPFMAALGWRS 153

  Fly    63 G-----GYWCGGSIIDHTWVLTAAHCTN-----------SANHVLIYFGASFRHEAQYTHWVSRS 111
            .     .|.|||::|.:.:|||||||.:           ..:::.:..|..          :|..
  Fly   154 NFDQRIYYRCGGALIANNFVLTAAHCADLGGEPPSQVRLGGDNLTLTEGED----------ISIR 208

  Fly   112 DMIQHPDWN-DFLNNDIALIRIPHVDFWSLVNKVEL-PSYNDRYNSYSGWWAVASGWGLTDNNSG 174
            .:|.|||:: ....|||||:.:      ....|.|| |:........:.....|.|:|.|.....
  Fly   209 RVIIHPDYSASTAYNDIALLEL------ETAAKPELKPTCIWTQKEVTNTLVTAIGYGQTSFAGL 267

  Fly   175 MSNYLNCVDVQIIDNNDCRNYYGSNYITDNTI----CI-NTDGGKSSCSGDSGGPLVLHDN--NR 232
            .|..|..|.::.:.|.:|:::|..:.:....:    |. :..|.:.:|.|||||||::.|.  ..
  Fly   268 SSAQLLKVPLKSVSNEECQHHYQKDQLAQGVLGTQMCAGDITGERDTCQGDSGGPLLMQDGLLGY 332

  Fly   233 IVGIVSFGSGEGCTAGRPAGFTRVTGYLDWIRDHTGIVY 271
            :|||.|.  |:||.:|.|:.:|||:.::|||.   |||:
  Fly   333 VVGITSL--GQGCASGPPSVYTRVSSFVDWIE---GIVW 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon44ENP_001286203.1 Tryp_SPc 40..263 CDD:214473 65/247 (26%)
Tryp_SPc 41..266 CDD:238113 67/249 (27%)
spiritNP_001162707.1 CLIP 51..98 CDD:197829 2/6 (33%)
Tryp_SPc 132..364 CDD:238113 67/252 (27%)
Tryp_SPc 132..361 CDD:214473 65/246 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45436963
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.