DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon44E and Prss30

DIOPT Version :9

Sequence 1:NP_001286203.1 Gene:Jon44E / 35853 FlyBaseID:FBgn0001285 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_011244785.1 Gene:Prss30 / 30943 MGIID:1353645 Length:347 Species:Mus musculus


Alignment Length:271 Identity:92/271 - (33%)
Similarity:129/271 - (47%) Gaps:35/271 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 ASAGVVPSESARAVPVKDMPRAGKIEGRITNGYPAYEGKIPYIVGLSFNDGGYWCGGSIIDHTWV 77
            |...::||....:   :|   ||||.|    |..|.||:.|:.|.|...:.|:.||||:|...||
Mouse    56 ARGDILPSVCGHS---RD---AGKIVG----GQDALEGQWPWQVSLWITEDGHICGGSLIHEVWV 110

  Fly    78 LTAAHC-TNSAN----HVLIYFGASFRHEAQYTHWVSRSDMIQHPD--WNDFLNNDIALIRIPHV 135
            |||||| ..|.|    ||.: .|.:......::..|:..::..||.  |.|..:.||||:::...
Mouse   111 LTAAHCFRRSLNPSFYHVKV-GGLTLSLLEPHSTLVAVRNIFVHPTYLWADASSGDIALVQLDTP 174

  Fly   136 DFWSLVNKVELPSYNDRYNSYSGWWAVASGWGLTDNNSGMSNYLNCVDVQIIDNNDCRNYY---- 196
            ...|....|.||:........:..|  .:|||.|.... |::.|..:.|.::|:.||...|    
Mouse   175 LRPSQFTPVCLPAAQTPLTPGTVCW--VTGWGATQERD-MASVLQELAVPLLDSEDCEKMYHTQG 236

  Fly   197 ----GSNYITDNTICIN-TDGGKSSCSGDSGGPLVLHDNN--RIVGIVSFGSGEGCTAG-RPAGF 253
                |...|..:.:|.. .:|.|.||.||||||||...|:  ..|||.|:|.  ||... ||..:
Mouse   237 SSLSGERIIQSDMLCAGYVEGQKDSCQGDSGGPLVCSINSSWTQVGITSWGI--GCARPYRPGVY 299

  Fly   254 TRVTGYLDWIR 264
            |||..|:|||:
Mouse   300 TRVPTYVDWIQ 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon44ENP_001286203.1 Tryp_SPc 40..263 CDD:214473 81/241 (34%)
Tryp_SPc 41..266 CDD:238113 83/243 (34%)
Prss30XP_011244785.1 Tryp_SPc 74..312 CDD:238113 85/247 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.