DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon44E and Cela3b

DIOPT Version :9

Sequence 1:NP_001286203.1 Gene:Jon44E / 35853 FlyBaseID:FBgn0001285 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001100162.1 Gene:Cela3b / 298567 RGDID:1307819 Length:269 Species:Rattus norvegicus


Alignment Length:283 Identity:79/283 - (27%)
Similarity:123/283 - (43%) Gaps:38/283 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLFVFLACLAVASAGVVPSESARAVPVKDMPRAGKIEGRITNGYPAYEGKIPYIVGLSFNDGG- 64
            ::|...|..:|:||....||.:.              ..|:.||..|.....|:.|.|.:...| 
  Rat     2 LRLLCSLLLVALASGCGQPSYNP--------------SSRVVNGEDAVPYSWPWQVSLQYEKDGS 52

  Fly    65 --YWCGGSIIDHTWVLTAAHCTNSANH---VLIYFGASFRHEAQYTHWVSRSDMIQHPDWND--- 121
              :.|||::|...||:||.||.:::..   ||..|........:....|:..|:..||.||.   
  Rat    53 FHHTCGGTLIAPDWVMTAGHCISTSRTYQVVLGEFERGVEEGPEQVIPVNAGDLFVHPKWNSNCV 117

  Fly   122 FLNNDIALIRIPH-VDFWSLVNKVELPSYNDRYNSYSGWWAVASGWGLTDNNSGMSNYLNCVDVQ 185
            ...|||||:::.. ......|....||...:...  :|.....||||....|..:.:.|....:.
  Rat   118 SCGNDIALVKLSRSAQLGDTVQLACLPPAGEILP--NGAPCYISGWGRLSTNGPLPDKLQQALLP 180

  Fly   186 IIDNNDCR--NYYGSNYITDNTICINTDGG--KSSCSGDSGGPLVLHDNN---RIVGIVSFGSGE 243
            ::|...|.  :::|.: :....:|.   ||  :|.|:|||||||.....|   ::.|:.||.|..
  Rat   181 VVDYAHCSKWDWWGFS-VKKTMVCA---GGDIQSGCNGDSGGPLNCPAENGTWQVHGVTSFVSSL 241

  Fly   244 GC-TAGRPAGFTRVTGYLDWIRD 265
            || |..:|..||||:.:.:||.:
  Rat   242 GCNTLKKPTVFTRVSAFNEWIEE 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon44ENP_001286203.1 Tryp_SPc 40..263 CDD:214473 70/240 (29%)
Tryp_SPc 41..266 CDD:238113 71/243 (29%)
Cela3bNP_001100162.1 Tryp_SPc 27..262 CDD:214473 70/240 (29%)
Tryp_SPc 28..265 CDD:238113 71/243 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 143 1.000 Inparanoid score I4367
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.