DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon44E and Tpsb2

DIOPT Version :9

Sequence 1:NP_001286203.1 Gene:Jon44E / 35853 FlyBaseID:FBgn0001285 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_062053.2 Gene:Tpsb2 / 29268 RGDID:3065 Length:274 Species:Rattus norvegicus


Alignment Length:286 Identity:97/286 - (33%)
Similarity:136/286 - (47%) Gaps:44/286 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLFVFLACLAVASAGVVPSESARAVPVKDMPRAGKIEGRITNGYPAYEGKIPYIVGLSFNDGGY 65
            :||.:.||...:||.     ..|...|||.  |.|.:.||     .|.|.|.|:.|.|.|. ..:
  Rat     2 LKLLLLLALSPLASL-----VHAAPCPVKQ--RVGIVGGR-----EASESKWPWQVSLRFK-FSF 53

  Fly    66 W---CGGSIIDHTWVLTAAHCTNSANHVLIYFGASFRHEAQYTHW------VSRSDMIQHPDWND 121
            |   ||||:|...||||||||..........|....|.  ||.::      |:|:  :.||.:..
  Rat    54 WMHFCGGSLIHPQWVLTAAHCVGLHIKSPELFRVQLRE--QYLYYADQLLTVNRT--VVHPHYYT 114

  Fly   122 FLNN-DIALIRIPH-VDFWSLVNKVELPSYNDRYNSYSGWWAVASGWGLTDNNSG-MSNY-LNCV 182
            ..:. ||||:.:.: |:..:.::...||..::.:.|.:..|  .:|||..|::.. :..| |..|
  Rat   115 VEDGADIALLELENPVNVSTHIHPTSLPPASETFPSGTSCW--VTGWGDIDSDEPLLPPYPLKQV 177

  Fly   183 DVQIIDNNDCRNYYGSNYITDNTICINTDG-------GKSSCSGDSGGPLVLHDNNRIV--GIVS 238
            .|.|::|:.|...|.:...|.:.:.|..||       ...||.||||||||.......:  |:||
  Rat   178 KVPIVENSLCDRKYHTGLYTGDDVPIVQDGMLCAGNTRSDSCQGDSGGPLVCKVKGTWLQAGVVS 242

  Fly   239 FGSGEGCT-AGRPAGFTRVTGYLDWI 263
            :  ||||. |.||..:||||.|||||
  Rat   243 W--GEGCAEANRPGIYTRVTYYLDWI 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon44ENP_001286203.1 Tryp_SPc 40..263 CDD:214473 82/245 (33%)
Tryp_SPc 41..266 CDD:238113 83/246 (34%)
Tpsb2NP_062053.2 Tryp_SPc 30..268 CDD:238113 85/251 (34%)
Tryp_SPc 30..266 CDD:214473 83/249 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.