DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon44E and Prss34

DIOPT Version :9

Sequence 1:NP_001286203.1 Gene:Jon44E / 35853 FlyBaseID:FBgn0001285 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001099242.1 Gene:Prss34 / 287140 RGDID:1306667 Length:316 Species:Rattus norvegicus


Alignment Length:290 Identity:90/290 - (31%)
Similarity:134/290 - (46%) Gaps:46/290 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LFVFLACLAVASAGVVPSESARAVPVKDMPRAGKIEGRITNGYPAYEGKIPYIVGLSFNDG--GY 65
            ||:.|.||            ...:|:  .|.:|:....|..|.|....:.|:.|.|.|.:.  ..
  Rat     9 LFLTLPCL------------GSTMPL--TPDSGQELVGIVGGCPVSASRFPWQVSLRFYNMKLSK 59

  Fly    66 W---CGGSIIDHTWVLTAAHCTN----SANHVLIYFGASFRHEAQYTHWVSRSDMIQHPDWNDFL 123
            |   ||||:|...||||||||..    .|:...:..|....:|......|::  :|:||.:::.|
  Rat    60 WEHICGGSLIHPQWVLTAAHCVELKEMEASCFRVQVGQLRLYENDQLMKVAK--IIRHPKFSEKL 122

  Fly   124 N----NDIALIRIPH-VDFWSLVNKVELPSYNDRYNSYSGWWAVASGWGLTDNNSGMSN--YLNC 181
            :    .||||:::.. |.....|:.|.||:.:.|.:|...||  .:|||:.:.:..:..  :|..
  Rat   123 SAPGGADIALLKLDSTVVLSERVHPVSLPAASQRISSKKTWW--VAGWGVIEGHRPLPPPCHLRE 185

  Fly   182 VDVQIIDNNDCRNYY--------GSNYITDNTICINTDGGKSSCSGDSGGPLVLHDNNR--IVGI 236
            |.|.|:.|:||...|        .:..|.|:.:|...: |:.||..|||||||...|..  .||:
  Rat   186 VAVPIVGNSDCEQKYRTYSSLDRTTKIIKDDMLCAGME-GRDSCQADSGGPLVCRWNCSWVQVGV 249

  Fly   237 VSFGSGEGCTAGRPAGFTRVTGYLDWIRDH 266
            ||:|.|.| ....|..:|||..||.||..:
  Rat   250 VSWGIGCG-LPDFPGVYTRVMSYLSWIHGY 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon44ENP_001286203.1 Tryp_SPc 40..263 CDD:214473 80/248 (32%)
Tryp_SPc 41..266 CDD:238113 82/250 (33%)
Prss34NP_001099242.1 Tryp_SPc 33..276 CDD:238113 81/248 (33%)
Tryp_SPc 33..275 CDD:214473 80/247 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.