DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon44E and Prss30

DIOPT Version :9

Sequence 1:NP_001286203.1 Gene:Jon44E / 35853 FlyBaseID:FBgn0001285 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_955403.2 Gene:Prss30 / 287106 RGDID:735142 Length:304 Species:Rattus norvegicus


Alignment Length:279 Identity:89/279 - (31%)
Similarity:130/279 - (46%) Gaps:38/279 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 VFLACLAVASAGVVPSESARAVPVKDMPRAGKIEGRITNGYPAYEGKIPYIVGLSFNDGGYWCGG 69
            :||..|.:.:.|       |.    |:..:|  .|:|..|..|.||:.|:.|.|.....|:.|||
  Rat     8 IFLLLLQILTGG-------RG----DILHSG--AGKIVGGQDAPEGRWPWQVSLRTEKEGHICGG 59

  Fly    70 SIIDHTWVLTAAHC-----TNSANHVLIYFGASFRHEAQYTHWVSRSDMIQHPD--WNDFLNNDI 127
            |:|...||||||||     .:|..||.: .|.:......::..|:..::..:|.  |.|..:.||
  Rat    60 SLIHEVWVLTAAHCFCRPLNSSFYHVKV-GGLTLSLTEPHSTLVAVRNIFVYPTYLWEDASSGDI 123

  Fly   128 ALIRIPHVDFWSLVNKVELPSYNDRYNSYSGWWAVASGWGLTDNNSGMSNYLNCVDVQIIDNNDC 192
            ||:|:......|..:.|.||.........:..|  .:|||.|.... :::.|..:.|.::|:.||
  Rat   124 ALLRLDTPLQPSQFSPVCLPQAQAPLTPGTVCW--VTGWGATHERE-LASVLQELAVPLLDSEDC 185

  Fly   193 RNYY--------GSNYITDNTICIN-TDGGKSSCSGDSGGPLVLHDNNR--IVGIVSFGSGEGCT 246
            ...|        |...|..:.:|.. .:|.|.||.||||||||...|:.  .|||.|:|.  ||.
  Rat   186 ERMYHIGETSLSGKRVIQSDMLCAGFVEGQKDSCQGDSGGPLVCAINSSWIQVGITSWGI--GCA 248

  Fly   247 -AGRPAGFTRVTGYLDWIR 264
             ..:|..:|||..|:|||:
  Rat   249 RPNKPGVYTRVPDYVDWIQ 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon44ENP_001286203.1 Tryp_SPc 40..263 CDD:214473 79/241 (33%)
Tryp_SPc 41..266 CDD:238113 81/243 (33%)
Prss30NP_955403.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.