DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon44E and CG18420

DIOPT Version :9

Sequence 1:NP_001286203.1 Gene:Jon44E / 35853 FlyBaseID:FBgn0001285 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_995715.1 Gene:CG18420 / 2768924 FlyBaseID:FBgn0028866 Length:299 Species:Drosophila melanogaster


Alignment Length:275 Identity:73/275 - (26%)
Similarity:117/275 - (42%) Gaps:52/275 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VASAGVVPSESARAVPVKDMPRAGKIEGRITNGYPAYEGKIPYIVGLSFNDGGYWCGGSIIDHTW 76
            :.|...:.||.....|:|..|       ||.||..|.....|::..|..:...:.|||::|....
  Fly    21 LGSTQFLDSECGTRSPLKLGP-------RIVNGKVAVRNSSPWMAFLHTSSNQFICGGTLISRRL 78

  Fly    77 VLTAAHCTNSANHVLIYFG------ASFRHEAQYTHWVSRSDMIQHPDWNDFLN-NDIALIRI-- 132
            |||||||......:::..|      ..:|.|    |.|:|:  .||..::...: |||||:|:  
  Fly    79 VLTAAHCFIPNTTIVVRLGEYNRKLKGYREE----HQVNRT--FQHRFYDPNTHANDIALLRLVS 137

  Fly   133 ---------PHVDFWSLVNKVELPSYNDRYNSYSGWWAVASGWGLTDNNSGMSNYLNCVDVQIID 188
                     |....|....|..:    |.....:|     :|||.|::... |:.|..:|:....
  Fly   138 NVVYKANIRPICIMWDASWKHHI----DSIKVLTG-----TGWGRTESMHD-SSELRTLDISRQP 192

  Fly   189 NNDCRNYYGSNYITDNTICINTDGGKSSCSGDSGGP---LVLHDNN-RIVGIVSFGSGEGCTAGR 249
            :..|.  :||  :..|..|.. :...:.|.||:|||   :|.:.|. |.|.:....:.:.|.  |
  Fly   193 SKMCA--FGS--VLSNQFCAG-NWNSNLCIGDTGGPVGAMVRYRNAFRFVQVGIAITNKRCQ--R 250

  Fly   250 PAGFTRVTGYLDWIR 264
            |:.||.|..::::||
  Fly   251 PSVFTDVMSHIEFIR 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon44ENP_001286203.1 Tryp_SPc 40..263 CDD:214473 65/244 (27%)
Tryp_SPc 41..266 CDD:238113 66/246 (27%)
CG18420NP_995715.1 Tryp_SPc 42..264 CDD:214473 65/244 (27%)
Tryp_SPc 43..267 CDD:238113 66/246 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435672
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.