DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon44E and Tpsg1

DIOPT Version :9

Sequence 1:NP_001286203.1 Gene:Jon44E / 35853 FlyBaseID:FBgn0001285 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_006524421.1 Gene:Tpsg1 / 26945 MGIID:1349391 Length:368 Species:Mus musculus


Alignment Length:281 Identity:81/281 - (28%)
Similarity:123/281 - (43%) Gaps:44/281 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VASAGVVPSESARAVPVKD---MPRAGKIEGRITNGYPAYEGKIPYIVGLSFNDGGYWCGGSIID 73
            |::.|..|...|.:|....   .|:......||..|:.|..|..|:...|..:. .:.||||::.
Mouse    55 VSARGQYPDSLANSVSSGSGCGHPQVSNSGSRIVGGHAAPAGTWPWQASLRLHK-VHVCGGSLLS 118

  Fly    74 HTWVLTAAHC----TNSANHVLIYFGASFRHEAQYT-----HWVSRSDMIQH-----PDWNDFLN 124
            ..||||||||    .||:::.:        |..:.|     |:.:...:|.:     |..:   :
Mouse   119 PEWVLTAAHCFSGSVNSSDYQV--------HLGELTVTLSPHFSTVKRIIMYTGSPGPPGS---S 172

  Fly   125 NDIALIRIPH-VDFWSLVNKVELPSYNDRYNSYSGWWAVASGWGLTDNNSGMSNYLNCVD--VQI 186
            .||||:::.. |...|.|..|.||..:..:  |.|.....:|||.|.....:....|..:  |.:
Mouse   173 GDIALVQLSSPVALSSQVQPVCLPEASADF--YPGMQCWVTGWGYTGEGEPLKPPYNLQEAKVSV 235

  Fly   187 IDNNDCRNYYGS---NYITDNTICINTDGGKSSCSGDSGGPLV--LHDNNRIVGIVSFGSGEGC- 245
            :|...|...|.|   :.|..:.:|....|  .:|..|||||||  :....:..|:||:  |||| 
Mouse   236 VDVKTCSQAYNSPNGSLIQPDMLCARGPG--DACQDDSGGPLVCQVAGTWQQAGVVSW--GEGCG 296

  Fly   246 TAGRPAGFTRVTGYLDWIRDH 266
            ...||..:.|||.|::||..|
Mouse   297 RPDRPGVYARVTAYVNWIHHH 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon44ENP_001286203.1 Tryp_SPc 40..263 CDD:214473 72/245 (29%)
Tryp_SPc 41..266 CDD:238113 73/247 (30%)
Tpsg1XP_006524421.1 Tryp_SPc 87..317 CDD:238113 73/247 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.