DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon44E and PRSS33

DIOPT Version :9

Sequence 1:NP_001286203.1 Gene:Jon44E / 35853 FlyBaseID:FBgn0001285 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001372391.1 Gene:PRSS33 / 260429 HGNCID:30405 Length:280 Species:Homo sapiens


Alignment Length:278 Identity:77/278 - (27%)
Similarity:117/278 - (42%) Gaps:32/278 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LACLAVASAGVVPSESARAVPVKDMPRAGKIEGRITNGYPAYEGKIPYIVGLSFNDGGYWCGGSI 71
            |..|.:.:||....:||..    ..||   :..||..|....:|:.|:...:. :.|.:.||||:
Human    10 LLLLVLGAAGTQGRKSAAC----GQPR---MSSRIVGGRDGRDGEWPWQASIQ-HRGAHVCGGSL 66

  Fly    72 IDHTWVLTAAHC----TNSANHVLIYFGASFRHEAQYTHWVSRSDMIQHPDWN-DFLNNDIALIR 131
            |...||||||||    ...|.:.:..........:..|..|....::..||:: |....|:||::
Human    67 IAPQWVLTAAHCFPRRALPAEYRVRLGALRLGSTSPRTLSVPVRRVLLPPDYSEDGARGDLALLQ 131

  Fly   132 IPH-VDFWSLVNKVELPSYNDRYNSYSGWWAVASGWGLTDNNSGMSNY--LNCVDVQIIDNNDCR 193
            :.. |...:.|..|.||....|  ...|.....:|||.......:..:  |..|.|.::|:..|.
Human   132 LRRPVPLSARVQPVCLPVPGAR--PPPGTPCRVTGWGSLRPGVPLPEWRPLQGVRVPLLDSRTCD 194

  Fly   194 NYY--------GSNYITDNTICIN-TDGGKSSCSGDSGGPLVLHDNNR--IVGIVSFGSGEGCT- 246
            ..|        ....:...::|.. ..|.|.:|.|||||||....:..  :||:||:  |:||. 
Human   195 GLYHVGADVPQAERIVLPGSLCAGYPQGHKDACQGDSGGPLTCLQSGSWVLVGVVSW--GKGCAL 257

  Fly   247 AGRPAGFTRVTGYLDWIR 264
            ..||..:|.|..|..||:
Human   258 PNRPGVYTSVATYSPWIQ 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon44ENP_001286203.1 Tryp_SPc 40..263 CDD:214473 67/242 (28%)
Tryp_SPc 41..266 CDD:238113 68/244 (28%)
PRSS33NP_001372391.1 Tryp_SPc 37..275 CDD:238113 67/242 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.