DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon44E and TPSG1

DIOPT Version :9

Sequence 1:NP_001286203.1 Gene:Jon44E / 35853 FlyBaseID:FBgn0001285 Length:271 Species:Drosophila melanogaster
Sequence 2:XP_011520748.1 Gene:TPSG1 / 25823 HGNCID:14134 Length:346 Species:Homo sapiens


Alignment Length:254 Identity:83/254 - (32%)
Similarity:117/254 - (46%) Gaps:33/254 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 PRAGKIEGRITNGYPAYEGKIPYIVGLSFNDGGYWCGGSIIDHTWVLTAAHC----TNSANHVLI 92
            |:.....|||..|:.|..|..|:...|... ..:.||||::...||||||||    .||::: .:
Human    54 PQVSDAGGRIVGGHAAPAGAWPWQASLRLR-RVHVCGGSLLSPQWVLTAAHCFSGSLNSSDY-QV 116

  Fly    93 YFGASFRHEAQYT---HWVSRSDMIQH--PDWNDFLNNDIALIR--IPHVDFWSLVNKVELPSYN 150
            :.|     |.:.|   |:.:...:|.|  |......:.||||:.  :| |...|.:..|.||..:
Human   117 HLG-----ELEITLSPHFSTVRQIILHSSPSGQPGTSGDIALVELSVP-VTLSSRILPVCLPEAS 175

  Fly   151 DRYNSYSGWWAVASGWGLTDNNSGM--SNYLNCVDVQIIDNNDCRNYY---GSNYITDNTICINT 210
            |.:......|  .:|||.|.....:  ...|..|.|.::|...||..|   |.:.:..:.:|...
Human   176 DDFCPGIRCW--VTGWGYTREGEPLPPPYSLREVKVSVVDTETCRRDYPGPGGSILQPDMLCARG 238

  Fly   211 DGGKSSCSGDSGGPLVLHDNNRIV--GIVSFGSGEGC-TAGRPAGFTRVTGYLDWIRDH 266
            .|  .:|..|||||||...|...|  |.||:  |||| ...||..:|||..|::|||.|
Human   239 PG--DACQDDSGGPLVCQVNGAWVQAGTVSW--GEGCGRPNRPGVYTRVPAYVNWIRRH 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon44ENP_001286203.1 Tryp_SPc 40..263 CDD:214473 77/241 (32%)
Tryp_SPc 41..266 CDD:238113 79/243 (33%)
TPSG1XP_011520748.1 Tryp_SPc 62..290 CDD:214473 77/241 (32%)
Tryp_SPc 63..293 CDD:238113 79/243 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.