DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon44E and CG30286

DIOPT Version :9

Sequence 1:NP_001286203.1 Gene:Jon44E / 35853 FlyBaseID:FBgn0001285 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_726082.3 Gene:CG30286 / 246529 FlyBaseID:FBgn0050286 Length:277 Species:Drosophila melanogaster


Alignment Length:257 Identity:67/257 - (26%)
Similarity:114/257 - (44%) Gaps:65/257 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 YPAYEGKIPYIVGLSFNDGGYWCGGSIIDHTWVLTAAHCTNSANHVLIYFG-------------- 95
            :.|:..:.|::..| ...|...|||::::|.::||||||.....::.:..|              
  Fly    39 HQAHISESPWMAYL-HKSGELVCGGTLVNHRFILTAAHCIREDENLTVRLGEFNSLTSIDCNGSD 102

  Fly    96 -----------ASFRHEAQYTHWVSRSDMIQHPDWNDFLNNDIALIRIP-------HVDFWSLVN 142
                       .:|||..     .||::.|          :||.|:|:.       |:....|:.
  Fly   103 CLPPSEDFEIDVAFRHGG-----YSRTNRI----------HDIGLLRLAKSVEYKVHIKPICLIT 152

  Fly   143 KVELPSYNDRYNSYSGWWAVASGWGLTDNNSGMSNYLNCVDVQIIDNNDCRNYYGSNYITDNTIC 207
            ...|....:|.:.     .||:|||.:.:.:. ::.|..:.|..::...|...|..:...|. ||
  Fly   153 NTTLQPKIERLHR-----LVATGWGRSPSEAA-NHILKSIRVTRVNWGVCSKTYWVDRRRDQ-IC 210

  Fly   208 INTDGGKSSCSGDSGGPL--VLHDNNRI----VGIVSFGSGEGCTAGRPAGFTRVTGYLDWI 263
            ::.:.| .|||||||||:  .:..:.|:    |||||:|:.| |.:  |:.||.|..::|||
  Fly   211 VSHESG-VSCSGDSGGPMGQAIRLDGRVLFVQVGIVSYGNAE-CLS--PSVFTNVMEHIDWI 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon44ENP_001286203.1 Tryp_SPc 40..263 CDD:214473 65/255 (25%)
Tryp_SPc 41..266 CDD:238113 67/257 (26%)
CG30286NP_726082.3 Tryp_SPc 39..269 CDD:238113 67/257 (26%)
Tryp_SPc 39..268 CDD:214473 65/255 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435675
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.