DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon44E and CG30187

DIOPT Version :9

Sequence 1:NP_001286203.1 Gene:Jon44E / 35853 FlyBaseID:FBgn0001285 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001246475.2 Gene:CG30187 / 246509 FlyBaseID:FBgn0050187 Length:500 Species:Drosophila melanogaster


Alignment Length:251 Identity:66/251 - (26%)
Similarity:108/251 - (43%) Gaps:50/251 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 RITNGY-PAYEGKIPYIVGLSFNDGGYWCGGSIIDHTWVLTAAHCTNSANHVLIYFGASFRHEAQ 103
            :||.|: .|::..:  .:....|...:.|||::|...:|||||||....:...:..||..:.:. 
  Fly    35 KITGGHNAAFQNSV--WMAAVHNRTHFICGGTLIHKRFVLTAAHCIVDQDVQSVSLGAYNKSDP- 96

  Fly   104 YTHWVSRSDMIQHPDWNDF-----LNNDIALIRI-PHVDFWSLVNKV------ELPSYNDRYNSY 156
                ..|.|:|.....:.|     ..|||.|::: ..|.|.:|:..:      .:.::.....::
  Fly    97 ----ADRKDVITAVVHSSFDVRASYENDIGLLKLSSDVIFNALIRPICIVLNKSMANHMRNMRTF 157

  Fly   157 SGWWAVASGWGLTDNNSGMSNYLNCVDVQIIDNNDCRNYYG-SNYITDNTICINTDGGKSSCSGD 220
            .     |.|||....|. .|:.|..:.:..:|..:|  |.. |.|.::..||.....| .:|.||
  Fly   158 K-----AFGWGTLRGNK-TSDILQTIILNHLDREEC--YMELSVYPSEKQICAGVPSG-DTCGGD 213

  Fly   221 SGGPLVLHD------NNRIV--GIVSFG----SGEGCTAGRPAGFTRVTGYLDWIR 264
            |||||. :|      .||.|  ||:|.|    .|:|.       :|.:..:.|||:
  Fly   214 SGGPLT-NDVFIQGIGNREVQFGIISVGKTSCDGQGV-------YTDLMSFADWIK 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon44ENP_001286203.1 Tryp_SPc 40..263 CDD:214473 64/248 (26%)
Tryp_SPc 41..266 CDD:238113 66/250 (26%)
CG30187NP_001246475.2 Tryp_SPc 35..260 CDD:214473 64/248 (26%)
Trypsin 316..>384 CDD:355628
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.