DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon44E and CG30098

DIOPT Version :9

Sequence 1:NP_001286203.1 Gene:Jon44E / 35853 FlyBaseID:FBgn0001285 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_725573.2 Gene:CG30098 / 246456 FlyBaseID:FBgn0050098 Length:264 Species:Drosophila melanogaster


Alignment Length:285 Identity:67/285 - (23%)
Similarity:115/285 - (40%) Gaps:88/285 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 CLAVASAGVVPSESARAVPVKDMPRAGKIEGRITNGYPAYEGKIPYIVGLSFNDGGYWCGGSIID 73
            |:|:....|:..::||..|                 :.||          ...|..:.||||:|.
  Fly    29 CIALFRIRVIGGQNARRTP-----------------WMAY----------LIRDNRFACGGSLIA 66

  Fly    74 HTWVLTAAHCTNSANHVLIYFGASFRHEAQYTHWVSRS----DMIQHPDWNDFLNNDIALIRIPH 134
            :.:||||||||...:::.:..|.  ...::.|...:||    .:.:|.::.||.|:|||::::  
  Fly    67 YRFVLTAAHCTKINDNLFVRLGE--YDSSRTTDGQTRSYRVVSIYRHKNYIDFRNHDIAVLKL-- 127

  Fly   135 VDFWSLVNKVELPSYNDR---YNSY---------SGWWAVA--------SGWGLTDNNSGMSNYL 179
                            ||   |::|         ||..::|        :|||...:...|...|
  Fly   128 ----------------DRQVVYDAYIRPICILLNSGLQSLANSIQNFTLTGWGQMAHYYKMPTTL 176

  Fly   180 NCVDVQIIDNNDCRNYYGSNYITDNTICINTDGGKSSCSGDSGGP---LVLHDNNRIVGIVSFGS 241
            ..:.::.:.|..|.       :...:||. .:..:.:|.||||||   ||.:.:..|  .|.||.
  Fly   177 QEMSLRRVRNEYCG-------VPSLSICC-WNPVQYACFGDSGGPLGSLVKYGHKTI--YVQFGV 231

  Fly   242 GEGCTAGRPAGFTR---VTGYLDWI 263
            ....| |...|::.   :..|:.|:
  Fly   232 TNSVT-GNCDGYSSYLDLMSYMPWL 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon44ENP_001286203.1 Tryp_SPc 40..263 CDD:214473 60/252 (24%)
Tryp_SPc 41..266 CDD:238113 61/253 (24%)
CG30098NP_725573.2 Tryp_SPc 36..254 CDD:214473 64/275 (23%)
Tryp_SPc 37..258 CDD:238113 65/277 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435688
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.