DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon44E and CG30090

DIOPT Version :9

Sequence 1:NP_001286203.1 Gene:Jon44E / 35853 FlyBaseID:FBgn0001285 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_725487.1 Gene:CG30090 / 246448 FlyBaseID:FBgn0050090 Length:291 Species:Drosophila melanogaster


Alignment Length:256 Identity:78/256 - (30%)
Similarity:117/256 - (45%) Gaps:33/256 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 PRAG----KIEGRITNGYPAYEGKIPYIVGLSFNDGGYWCGGSIIDHTWVLTAAHCTNSANHVLI 92
            ||.|    .|..:|..|..|.....|::..: .:.....|||::|...:|||||||.|..:.|.:
  Fly    27 PRCGLTANTIAFKIIGGRDAIINSNPWMAYI-HSSVKLICGGTLITQRFVLTAAHCVNEGSAVKV 90

  Fly    93 YFGA---SFRHEAQYTHWVSRS-----DM-IQHPDWNDFLN-NDIALIRI-PHVDFWSLVNKVEL 146
            ..|.   :...:......:.|:     || .:|..:::..| |||||:|: ..|.|.:.::.:.:
  Fly    91 RLGEYDDTATEDCNSKICIPRAEEHDVDMAFRHGKFSEIKNLNDIALLRLAKFVTFKAHISPICI 155

  Fly   147 ---PSYNDRYNSYSGWWAVASGWGLTDNNSGMSNYLNCVDVQIIDNNDCRNYYGSNYITDNTICI 208
               .|..:..:|..  |.||:|||.|..:. ....|....:|..:::.|....| ..:..|.||.
  Fly   156 ILGTSKRELVDSIE--WFVATGWGETRTHR-TRGVLQITQLQRYNSSQCMQALG-RLVQQNQICA 216

  Fly   209 NTDGGKSSCSGDSGGPL---VLH-DNNRIV--GIVSFGSGEGCTAGRPAGFTRVTGYLDWI 263
            .. .|..:|:|||||||   |.| |..|.|  |:||:||.|....|   .:|.|..|.|||
  Fly   217 GR-LGSDTCNGDSGGPLFQTVRHMDKMRPVQFGVVSYGSRECSGIG---VYTDVYSYADWI 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon44ENP_001286203.1 Tryp_SPc 40..263 CDD:214473 72/242 (30%)
Tryp_SPc 41..266 CDD:238113 74/243 (30%)
CG30090NP_725487.1 Tryp_SPc 39..273 CDD:214473 72/242 (30%)
Tryp_SPc 40..276 CDD:238113 74/243 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435669
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.