DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon44E and CG30082

DIOPT Version :9

Sequence 1:NP_001286203.1 Gene:Jon44E / 35853 FlyBaseID:FBgn0001285 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001188942.1 Gene:CG30082 / 246443 FlyBaseID:FBgn0050082 Length:280 Species:Drosophila melanogaster


Alignment Length:305 Identity:77/305 - (25%)
Similarity:115/305 - (37%) Gaps:87/305 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FVFLACLAVASAGVVPSESARAVPVKDMPRAGKI-----EGRITNGYPAYEGKIPYIVGLSFNDG 63
            |.||.||       .|...|:.:.    |..|..     ..||..|..|..|..|::..|..| .
  Fly     9 FAFLVCL-------TPKLRAQFID----PNCGTTINLPPTNRIVGGRTADIGSNPWLAYLHKN-S 61

  Fly    64 GYWCGGSIIDHTWVLTAAHCTNSANHVLIYFG-------------------ASFRHEAQYTH--W 107
            ...|.|::|...:|||||||.:|.:.:.:..|                   ..:..|..|.|  :
  Fly    62 SLVCTGTLITKRFVLTAAHCLHSFHLLTVRLGEYDTSTRIDCTSEFCIPTYEEYSVENAYIHTFF 126

  Fly   108 VSRSDMIQHPDWNDFLNNDIALIRIPHVDFWSLV--------NKVELPSYNDRYNSYSGWWAVAS 164
            ..|.|.          .|||.|:::.....:.|.        :..::| |:..|.        |:
  Fly   127 GGRQDS----------RNDIGLLKLNGTVVYKLFIRPICLFRDPGQVP-YSSTYE--------AA 172

  Fly   165 GWGLTD--NNSGMSNYLNCVDVQIIDNNDCRNYYGSNYITDNTICINTDGGK---SSCSGDSGGP 224
            |||..|  |.   :..|..|::..:|.:||.....:: ::....|    .|:   .:||||||||
  Fly   173 GWGKIDLINT---ATVLQTVNLIRLDQSDCERSLRTS-LSYGQFC----AGQWRADTCSGDSGGP 229

  Fly   225 LVLH-DNNRI-----VGIVSFGSGEGCTAGRPAGFTRVTGYLDWI 263
            |... .|.||     :||||:|.   .....|..:|.|..:.:||
  Fly   230 LSRKMSNGRITRTVQLGIVSYGH---YLCRGPGVYTYVPSFTNWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon44ENP_001286203.1 Tryp_SPc 40..263 CDD:214473 66/262 (25%)
Tryp_SPc 41..266 CDD:238113 67/263 (25%)
CG30082NP_001188942.1 Tryp_SPc 39..271 CDD:214473 66/262 (25%)
Tryp_SPc 40..274 CDD:238113 67/263 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435678
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
21.930

Return to query results.
Submit another query.