DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon44E and Cela1

DIOPT Version :9

Sequence 1:NP_001286203.1 Gene:Jon44E / 35853 FlyBaseID:FBgn0001285 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_036684.1 Gene:Cela1 / 24331 RGDID:2547 Length:266 Species:Rattus norvegicus


Alignment Length:268 Identity:83/268 - (30%)
Similarity:120/268 - (44%) Gaps:55/268 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 KDMPRAGKIEGRITNGYPAYEGKIPYIVGLSFNDGGYW---CGGSIIDHTWVLTAAHCTNSANHV 90
            :|.|   :...|:..|..|.....|..:.|.:..||.|   |||::|...||:|||||.:|....
  Rat    18 QDFP---ETNARVVGGAEARRNSWPSQISLQYLSGGSWYHTCGGTLIRRNWVMTAAHCVSSQMTF 79

  Fly    91 LIYFGASFRHEAQYT-HWVSRSDMIQHPDWNDFLNN-----DIALIRIPHVDFWSLVNKVEL--- 146
            .:..|.....:...| .:||...::.||:||.  ||     ||||:|:  ....:|.|.|:|   
  Rat    80 RVVVGDHNLSQNDGTEQYVSVQKIVVHPNWNS--NNVAAGYDIALLRL--AQSVTLNNYVQLAVL 140

  Fly   147 -----------PSYNDRYNSYSGWWAVASGWGLTDNNSGMSN-----YLNCVDVQIIDNNDCRNY 195
                       |.|             .:|||.|..|..:|.     ||..||..|..::   :|
  Rat   141 PQEGTILANNNPCY-------------ITGWGRTRTNGQLSQTLQQAYLPSVDYSICSSS---SY 189

  Fly   196 YGSNYITDNTICINTDGGKSSCSGDSGGPL--VLHDNNRIVGIVSFGSGEGCTAGR-PAGFTRVT 257
            :||. :....:|...||.:|.|.|||||||  :::....:.|:.||.|..||...| |..||||:
  Rat   190 WGST-VKTTMVCAGGDGVRSGCQGDSGGPLHCLVNGQYSVHGVTSFVSSMGCNVSRKPTVFTRVS 253

  Fly   258 GYLDWIRD 265
            .|:.|:.:
  Rat   254 AYISWMNN 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon44ENP_001286203.1 Tryp_SPc 40..263 CDD:214473 80/253 (32%)
Tryp_SPc 41..266 CDD:238113 80/256 (31%)
Cela1NP_036684.1 Tryp_SPc 26..258 CDD:214473 80/252 (32%)
Tryp_SPc 27..262 CDD:238113 80/256 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 143 1.000 Inparanoid score I4367
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.