DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon44E and Cela3a

DIOPT Version :9

Sequence 1:NP_001286203.1 Gene:Jon44E / 35853 FlyBaseID:FBgn0001285 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001119790.1 Gene:Cela3a / 242711 MGIID:3651647 Length:283 Species:Mus musculus


Alignment Length:296 Identity:80/296 - (27%)
Similarity:127/296 - (42%) Gaps:50/296 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLFVFLACLAVASAGVVPSESARAVPVKDMPRAGKIEGRITNGYPAYEGKIPYIVGLSFNDGG- 64
            ::|...|..:|:||....||.:.              ..|:.||..|.....|:.|.|.:..|| 
Mouse     2 LRLLSSLLLVALASGCGQPSHNP--------------SSRVVNGEEAVPHSWPWQVSLQYEMGGS 52

  Fly    65 --YWCGGSIIDHTWVLTAAHCTNSANHVLIYFGASFRHE------AQYTHWVSRSDMIQHPDWN- 120
              :.||||:|...|||||.||.....:..:..|   .||      ::....::..::..||.|| 
Mouse    53 FHHTCGGSLITPDWVLTAGHCIMPYLNYRVVLG---EHEHGVEEGSEQVIPINAGELFVHPKWNS 114

  Fly   121 DFLN--NDIALIRIPH-VDFWSLVNKVELPSYNDRYNSYSGWWAVASGWGLTDNNSGMSNYLNCV 182
            :.:|  |:|||:::.. ......|....||...:...  :|.....||||....|..:...|...
Mouse   115 ECVNCGNNIALVKLSRSAQLGDAVQLACLPPAGEILP--NGAPCYISGWGRLSTNGPLPTKLQQA 177

  Fly   183 DVQIIDNNDCRNY-YGSNYITDNTIC---------INTDGGK----SSCSGDSGGPLVLHDNN-- 231
            .:.::|...|..: :..:|:....:|         :::|..:    |...|||||||....:|  
Mouse   178 LLPVVDYEHCSRWDWWGHYVKRTMVCAGGYIQAHSLSSDTHQPRLLSPLQGDSGGPLNCPADNGT 242

  Fly   232 -RIVGIVSFGSGEGC-TAGRPAGFTRVTGYLDWIRD 265
             ::.||.||.|..|| |..:|..||||:.::|||.:
Mouse   243 WQVHGIASFVSPSGCNTLKKPTMFTRVSAFIDWIEE 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon44ENP_001286203.1 Tryp_SPc 40..263 CDD:214473 71/253 (28%)
Tryp_SPc 41..266 CDD:238113 72/256 (28%)
Cela3aNP_001119790.1 Tryp_SPc 27..276 CDD:214473 71/253 (28%)
Tryp_SPc 28..279 CDD:238113 72/256 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 147 1.000 Inparanoid score I4390
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.