DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon44E and TPSD1

DIOPT Version :9

Sequence 1:NP_001286203.1 Gene:Jon44E / 35853 FlyBaseID:FBgn0001285 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_036349.1 Gene:TPSD1 / 23430 HGNCID:14118 Length:242 Species:Homo sapiens


Alignment Length:248 Identity:77/248 - (31%)
Similarity:111/248 - (44%) Gaps:33/248 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKLFVFLACLAVAS-AGVVPSESARAVPVKDMPRAGKIEGRITNGYPAYEGKIPYIVGLSFNDGG 64
            |...:.||...:|| |.|.|:      |.:.:.:.|     |..|..|...|.|:.|.|... |.
Human     8 MLSLLLLALPVLASPAYVAPA------PGQALQQTG-----IVGGQEAPRSKWPWQVSLRVR-GP 60

  Fly    65 YW---CGGSIIDHTWVLTAAHCTNSANHVLIYFGASFRHEAQY--THWVSRSDMIQHPDWNDFLN 124
            ||   ||||:|...||||||||.......|.......|.:..|  ...:..|.:|.||.:.....
Human    61 YWMHFCGGSLIHPQWVLTAAHCVEPDIKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYIIQT 125

  Fly   125 N-DIALIRIPH-VDFWSLVNKVELPSYNDRYNSYSGWWAVASGWGLTDNNSGM-SNY-LNCVDVQ 185
            . ||||:.:.. |:..|.::.|.||..::.:......|  .:|||..|||..: ..| |..|:|.
Human   126 GADIALLELEEPVNISSHIHTVTLPPASETFPPGMPCW--VTGWGDVDNNVHLPPPYPLKEVEVP 188

  Fly   186 IIDNNDCRNYY------GSNY--ITDNTICINTDGGKSSCSGDSGGPLVLHDN 230
            :::|:.|...|      |.::  :.|:.:|..:: ...||.||||||||...|
Human   189 VVENHLCNAEYHTGLHTGHSFQIVRDDMLCAGSE-NHDSCQGDSGGPLVCKVN 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon44ENP_001286203.1 Tryp_SPc 40..263 CDD:214473 67/208 (32%)
Tryp_SPc 41..266 CDD:238113 67/207 (32%)
TPSD1NP_036349.1 Tryp_SPc 38..242 CDD:238113 67/207 (32%)
Tryp_SPc 38..240 CDD:214473 66/205 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.