DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon44E and try-5

DIOPT Version :9

Sequence 1:NP_001286203.1 Gene:Jon44E / 35853 FlyBaseID:FBgn0001285 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_505421.3 Gene:try-5 / 187088 WormBaseID:WBGene00006623 Length:327 Species:Caenorhabditis elegans


Alignment Length:241 Identity:58/241 - (24%)
Similarity:86/241 - (35%) Gaps:85/241 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 CGGSIIDHTWVLTAAHCTNSANHVLIYFGAS---------------------------------- 97
            |||::|....|||||||...      :|||.                                  
 Worm    73 CGGTLITLKHVLTAAHCFQK------HFGAKKEGGEENSMSGRYCESNQRFTDSEILTRTVVTVG 131

  Fly    98 ---FRHEAQY----------THWVSRSDMIQHPDWNDFL------NNDIALIRIPHVDFWSLVNK 143
               .|.|.:|          |..:||..:      .||.      .|||.::.:.     |.::.
 Worm   132 AMCTRLEQKYGCVNEKQNGKTLKISRFAI------GDFYKTHCEQGNDIVILELE-----STIDD 185

  Fly   144 VELPSYN-----DRYNSYSGWWAVASGWGLTDNNSGMSN----YLNCVDVQIIDNNDCRNYYGSN 199
            ||..:|.     ...|..||....:.||| :|...|..|    .:..:.:.......|...:|::
 Worm   186 VEGANYACLPFLPEVNIQSGANVTSFGWG-SDPGKGFDNAAFPMIQVLTLATETLATCEENWGTS 249

  Fly   200 YITDNTICINTDGGKSSCSGDSGGPLVLHDNNR----IVGIVSFGS 241
             |..::.|...:..|:.|||||||.|..|.::.    |:.|||:||
 Worm   250 -IPFDSFCTAEEEDKNVCSGDSGGGLTFHQSDSAREFIIAIVSYGS 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon44ENP_001286203.1 Tryp_SPc 40..263 CDD:214473 58/241 (24%)
Tryp_SPc 41..266 CDD:238113 58/241 (24%)
try-5NP_505421.3 Tryp_SPc 48..296 CDD:389826 58/241 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 70 1.000 Domainoid score I6224
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.100

Return to query results.
Submit another query.