DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon44E and try-4

DIOPT Version :9

Sequence 1:NP_001286203.1 Gene:Jon44E / 35853 FlyBaseID:FBgn0001285 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_508030.4 Gene:try-4 / 185148 WormBaseID:WBGene00006622 Length:324 Species:Caenorhabditis elegans


Alignment Length:283 Identity:74/283 - (26%)
Similarity:112/283 - (39%) Gaps:70/283 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 EGKI---PYIVGLSFNDGGYWCGGSIIDHTWVLTAAH------------CTNS------------ 86
            |.||   |:.|..:. ||....|||||....::||||            |.|.            
 Worm    52 ESKIKNFPWAVSFTV-DGVNRLGGSIISPYHIITAAHGFITTIGSRGNLCENKNWKKPNSSIYRS 115

  Fly    87 -----ANHVLIYFGASFR-HEAQYTH--WVSRSDMI-----------QHPDWNDFLNNDIALIRI 132
                 ....:.|.|...| |..:|.:  ...:||:|           :....|....:|.|::.:
 Worm   116 IKFLRDTRKVAYGGTCIRGHTDKYPNDPRCKKSDVIHNKVRAVLVDGEFASSNCLKGHDWAIVEV 180

  Fly   133 -PHVDFWSLVNKVELPSYNDRYNSYSGWWAVASGWGLT--DNNSGMSNYLNCVDVQIIDNNDCRN 194
             ..:.|...|..:.||    |.|.|........|||.:  .|.||  ..::.:.::|  :.||:.
 Worm   181 EKRIHFSENVRPICLP----RPNMYYTKSLAVPGWGRSYIFNESG--PLIHEIPMRI--DRDCKR 237

  Fly   195 YYGSNY--ITDNTIC-----INTDGGKSSCSGDSGGPLVLHDNNR----IVGIVSFGSGEGCTAG 248
            .:....  ..|:.||     ::......:|.|||||.|...|:|.    ::.|.|||: .||.:.
 Worm   238 PWSDRLPADADDFICATSMNVSNYSAPRTCHGDSGGGLEYRDDNYGRAFLIAITSFGT-RGCPSN 301

  Fly   249 RPAGFTRVTGYLDWIRDHTGIVY 271
            ..|.||||..||:.|.::||:.|
 Worm   302 MLARFTRVDMYLNLICNYTGVCY 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon44ENP_001286203.1 Tryp_SPc 40..263 CDD:214473 70/273 (26%)
Tryp_SPc 41..266 CDD:238113 71/276 (26%)
try-4NP_508030.4 Tryp_SPc 51..318 CDD:238113 71/275 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.