DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon44E and try-3

DIOPT Version :9

Sequence 1:NP_001286203.1 Gene:Jon44E / 35853 FlyBaseID:FBgn0001285 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001367393.1 Gene:try-3 / 183420 WormBaseID:WBGene00006621 Length:313 Species:Caenorhabditis elegans


Alignment Length:270 Identity:79/270 - (29%)
Similarity:120/270 - (44%) Gaps:65/270 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 PAYEGKIPYIVGLSFNDGGYW---------------CGGSIIDHTWVLTAAHCTNSANHVLIYFG 95
            |.:..:|  |.|.|.:||..|               ||.::||..|::|||||      .|....
 Worm    32 PIFSFRI--IGGNSIDDGANWMAKLVSYGDNGQGILCGATVIDDFWLVTAAHC------ALQLQT 88

  Fly    96 ASFRHEAQYTHWVSRSDMIQ----HPDWND-FLNNDIALIRIPHVDFWSLVNKVELPSYND---- 151
            .||.:..:..:...||..::    |..:|: ..:|||||:||.. |...|..|.....::|    
 Worm    89 RSFVYVREPKNNRERSFSVKEAYIHSGYNNQTADNDIALLRISS-DLSKLGIKPVCLVHDDSKLL 152

  Fly   152 -RYNSYSGWWAVASGWGLT--DNNSG-----MSNYLNCVDVQIIDNNDCRNYYG-----SNYITD 203
             :|.:     .|..|:|||  :::||     .|..|....|.||.::||...:.     |..||.
 Worm   153 KQYKN-----GVVIGYGLTLGEDSSGEPKLINSQTLQSTSVPIISDDDCVKTWRFLSLLSVKITG 212

  Fly   204 NTICINTDGG--KSSCSGDSGGPLVLHDNNR---IVGIVSFGSGEGCTA----GR-PAGFTRVTG 258
            ..||.   |.  ..:..|||||||::|.:|.   .:||.|:|: :|...    |: |..:||::.
 Worm   213 YQICA---GAYLHGTAPGDSGGPLLIHKSNGEYVQIGITSYGA-DGLDGVIDQGKFPGVYTRISK 273

  Fly   259 YLDWIRDHTG 268
            |:.||:...|
 Worm   274 YVPWIQGVIG 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon44ENP_001286203.1 Tryp_SPc 40..263 CDD:214473 76/263 (29%)
Tryp_SPc 41..266 CDD:238113 78/266 (29%)
try-3NP_001367393.1 Tryp_SPc 38..279 CDD:238113 76/258 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24260
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.