DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon44E and svh-1

DIOPT Version :9

Sequence 1:NP_001286203.1 Gene:Jon44E / 35853 FlyBaseID:FBgn0001285 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_501379.2 Gene:svh-1 / 182375 WormBaseID:WBGene00006620 Length:951 Species:Caenorhabditis elegans


Alignment Length:282 Identity:77/282 - (27%)
Similarity:118/282 - (41%) Gaps:43/282 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LACLAVASAGVVPSESARAVPVKDMPRAGKIEGRITNGYPAYEGKIPYIVGLSFNDG--GYWCGG 69
            ::|::............|.|.|.....|.....|:..|:....|..|:...|. |..  .:.||.
 Worm   679 ISCISQNGMSSASQCGLRYVEVNARDAAKSRIARVVGGFETVPGAFPWTAALR-NKATKAHHCGA 742

  Fly    70 SIIDHTWVLTAAHCTNSANHVLIYFGASFRHEAQYTHWVSRSD-------MIQ----HPDWNDFL 123
            ||:|.|.::|||||......|..|       |.....|.:...       .:|    :|.:.|..
 Worm   743 SILDKTHLITAAHCFEEDERVSSY-------EVVVGDWDNNQTDGNEQIFYLQRIHFYPLYKDIF 800

  Fly   124 NNDIALIRIPH--VDFWSLVNKVELPSYNDRYNSYSGWWAVASGWGLTDNNSGM--SNYLNCVDV 184
            ::|||::.||:  ::|......:.|||.:..|.  .|...|.||||    :.|:  :..|....:
 Worm   801 SHDIAILEIPYPGIEFNEYAQPICLPSKDFVYT--PGRQCVVSGWG----SMGLRYAERLQAALI 859

  Fly   185 QIIDNNDCRN---YYGSNYITDNTICIN-TDGGKSSCSGDSGGPLVLHDNNR---IVGIVSFGSG 242
            .||:..||.|   .|.|  ::.:..|.. .:||..||.||||||......:.   :.|::|:  |
 Worm   860 PIINRFDCVNSSQIYSS--MSRSAFCAGYLEGGIDSCQGDSGGPFACRREDGAFVLAGVISW--G 920

  Fly   243 EGCTAGRPAG-FTRVTGYLDWI 263
            :||...:..| :|.|..||.||
 Worm   921 DGCAQKKQPGIYTMVAPYLSWI 942

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon44ENP_001286203.1 Tryp_SPc 40..263 CDD:214473 70/247 (28%)
Tryp_SPc 41..266 CDD:238113 71/248 (29%)
svh-1NP_501379.2 KR 227..306 CDD:214527
LDLa 320..355 CDD:238060
PAN_AP_HGF 373..434 CDD:238532
LDLa 558..590 CDD:197566
SRCR_2 599..681 CDD:382996 0/1 (0%)
Tryp_SPc 713..945 CDD:238113 71/248 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.