DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon44E and Tpsb2

DIOPT Version :9

Sequence 1:NP_001286203.1 Gene:Jon44E / 35853 FlyBaseID:FBgn0001285 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_034911.3 Gene:Tpsb2 / 17229 MGIID:96942 Length:276 Species:Mus musculus


Alignment Length:260 Identity:88/260 - (33%)
Similarity:125/260 - (48%) Gaps:34/260 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 VKDMPRAGKIEGRITNGYPAYEGKIPYIVGLSFNDGGYW---CGGSIIDHTWVLTAAHCTNSANH 89
            |...||.......|..|:.|.|.|.|:.|.|.|. ..||   ||||:|...||||||||......
Mouse    19 VYSAPRPANQRVGIVGGHEASESKWPWQVSLRFK-LNYWIHFCGGSLIHPQWVLTAAHCVGPHIK 82

  Fly    90 VLIYFGASFRHEAQYTHW----VSRSDMIQHPDWNDFLNN-DIAL--IRIPHVDFWSLVNKVELP 147
            ....|....|.  ||.::    :|.:.::.||.:...... |:||  :.:| |:..:.::.:.||
Mouse    83 SPQLFRVQLRE--QYLYYGDQLLSLNRIVVHPHYYTAEGGADVALLELEVP-VNVSTHLHPISLP 144

  Fly   148 SYNDRYNSYSGWWAVASGWGLTDNNSGM-SNY-LNCVDVQIIDNNDC-RNYYGSNY-------IT 202
            ..::.:...:..|  .:|||..||:..: ..| |..|.|.|::|:.| |.|:...|       :.
Mouse   145 PASETFPPGTSCW--VTGWGDIDNDEPLPPPYPLKQVKVPIVENSLCDRKYHTGLYTGDDFPIVH 207

  Fly   203 DNTICI-NTDGGKSSCSGDSGGPLVLHDNNRIV--GIVSFGSGEGCT-AGRPAGFTRVTGYLDWI 263
            |..:|. ||  .:.||.||||||||.......:  |:||:  ||||. ..:|..:||||.|||||
Mouse   208 DGMLCAGNT--RRDSCQGDSGGPLVCKVKGTWLQAGVVSW--GEGCAQPNKPGIYTRVTYYLDWI 268

  Fly   264  263
            Mouse   269  268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon44ENP_001286203.1 Tryp_SPc 40..263 CDD:214473 83/246 (34%)
Tryp_SPc 41..266 CDD:238113 85/247 (34%)
Tpsb2NP_034911.3 Tryp_SPc 32..270 CDD:238113 85/247 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.