DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon44E and CTRL

DIOPT Version :9

Sequence 1:NP_001286203.1 Gene:Jon44E / 35853 FlyBaseID:FBgn0001285 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001898.1 Gene:CTRL / 1506 HGNCID:2524 Length:264 Species:Homo sapiens


Alignment Length:233 Identity:88/233 - (37%)
Similarity:125/233 - (53%) Gaps:17/233 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 RITNGYPAYEGKIPYIVGLSFNDGGYWCGGSIIDHTWVLTAAHCTNSANHVLIYFGASFR-HEAQ 103
            ||.||..|..|..|:.|.|..:.|.::||||:|..:||:|||||..|.....:..|...| ..|:
Human    33 RIVNGENAVLGSWPWQVSLQDSSGFHFCGGSLISQSWVVTAAHCNVSPGRHFVVLGEYDRSSNAE 97

  Fly   104 YTHWVSRSDMIQHPDWND-FLNNDIALIRIPH-VDFWSLVNKVELPSYNDRYNSYSGWWAVASGW 166
            ....:|.|..|.||.||. .:|||:.|:::.. ..:.:.::.|.|.|.|:...  .|...|.:||
Human    98 PLQVLSVSRAITHPSWNSTTMNNDVTLLKLASPAQYTTRISPVCLASSNEALT--EGLTCVTTGW 160

  Fly   167 GLTDNNSGMSN----YLNCVDVQIIDNNDCRNYYGSNYITDNTICINTDGGKSSCSGDSGGPLVL 227
            |   ..||:.|    :|..|.:.::..|.||.|:||: |||:.||.. ..|.|||.||||||||.
Human   161 G---RLSGVGNVTPAHLQQVALPLVTVNQCRQYWGSS-ITDSMICAG-GAGASSCQGDSGGPLVC 220

  Fly   228 HDNNR--IVGIVSFGSGEGCTAGRPAGFTRVTGYLDWI 263
            ...|.  ::||||:|: :.|....||.:|||:.:..||
Human   221 QKGNTWVLIGIVSWGT-KNCNVRAPAVYTRVSKFSTWI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon44ENP_001286203.1 Tryp_SPc 40..263 CDD:214473 86/231 (37%)
Tryp_SPc 41..266 CDD:238113 87/232 (38%)
CTRLNP_001898.1 Tryp_SPc 34..260 CDD:238113 87/232 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.