DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon44E and F9

DIOPT Version :9

Sequence 1:NP_001286203.1 Gene:Jon44E / 35853 FlyBaseID:FBgn0001285 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_032005.1 Gene:F9 / 14071 MGIID:88384 Length:471 Species:Mus musculus


Alignment Length:246 Identity:73/246 - (29%)
Similarity:123/246 - (50%) Gaps:31/246 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 RITNGYPAYEGKIPYIVGLSFNDGGYWCGGSIIDHTWVLTAAHCTNSANHVLIYFG---ASFRHE 101
            |:..|..|..|:||:.|.|: .:...:|||:||:..|::|||||....:.:.:..|   ...:.:
Mouse   236 RVVGGENAKPGQIPWQVILN-GEIEAFCGGAIINEKWIVTAAHCLKPGDKIEVVAGEYNIDKKED 299

  Fly   102 AQYTHWVSRSDMIQHPDWNDFLN---NDIALIRIPHVDFWSLVNKVELP------SYNDRYNSY- 156
            .:....|.|:  |.|..:|..:|   :||||:.:   |...::|....|      .|.:.:..: 
Mouse   300 TEQRRNVIRT--IPHHQYNATINKYSHDIALLEL---DKPLILNSYVTPICVANREYTNIFLKFG 359

  Fly   157 SGWWAVASGWGLTDNNSGMSNYLNCVDVQIIDNNDCRNYYGSNY-ITDNTICIN-TDGGKSSCSG 219
            ||:   .||||...|....::.|..:.|.::|...|..  .:.: |.:|..|.. .:|||.||.|
Mouse   360 SGY---VSGWGKVFNKGRQASILQYLRVPLVDRATCLR--STTFTIYNNMFCAGYREGGKDSCEG 419

  Fly   220 DSGGPLV--LHDNNRIVGIVSFGSGEGCT-AGRPAGFTRVTGYLDWIRDHT 267
            |||||.|  :...:.:.||:|:  ||.|. .|:...:|:|:.|::||::.|
Mouse   420 DSGGPHVTEVEGTSFLTGIISW--GEECAMKGKYGIYTKVSRYVNWIKEKT 468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon44ENP_001286203.1 Tryp_SPc 40..263 CDD:214473 70/240 (29%)
Tryp_SPc 41..266 CDD:238113 71/242 (29%)
F9NP_032005.1 GLA 28..92 CDD:214503
EGF_CA 93..129 CDD:238011
FXa_inhibition 134..170 CDD:291342
Tryp_SPc 236..464 CDD:214473 70/240 (29%)
Tryp_SPc 237..467 CDD:238113 71/242 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.