DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon44E and Cela2a

DIOPT Version :9

Sequence 1:NP_001286203.1 Gene:Jon44E / 35853 FlyBaseID:FBgn0001285 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_031945.1 Gene:Cela2a / 13706 MGIID:95316 Length:271 Species:Mus musculus


Alignment Length:261 Identity:85/261 - (32%)
Similarity:122/261 - (46%) Gaps:41/261 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 IEGRITNGYPAYE----------------GKIPYIVGLSFNDGGYW---CGGSIIDHTWVLTAAH 82
            :.|.::.|||.||                ...|:.|.|.....|.|   ||||::.:.|||||||
Mouse    11 VAGALSCGYPTYEVEDDVSRVVGGQEATPNTWPWQVSLQVLSSGRWRHNCGGSLVANNWVLTAAH 75

  Fly    83 CTNSANHVLIYFGA-SFRHEAQYTHWVSRSDMIQHPDWN-DFLNN--DIALIRIPH-VDFWSLVN 142
            |.::.....:..|| |..:....:..|..|.::.|..|| ..:.|  |||||::.. |.....:.
Mouse    76 CLSNYQTYRVLLGAHSLSNPGAGSAAVQVSKLVVHQRWNSQNVGNGYDIALIKLASPVTLSKNIQ 140

  Fly   143 KVELPSYND----RYNSYSGWWAVASGWGLTDNNSGMSNYLNCVDVQIIDNNDC--RNYYGSNYI 201
            ...||....    .|..|      .:||||...|....:.|....:.::|...|  .:::||: :
Mouse   141 TACLPPAGTILPRNYVCY------VTGWGLLQTNGNSPDTLRQGRLLVVDYATCSSASWWGSS-V 198

  Fly   202 TDNTICINTDGGKSSCSGDSGGPLVLHDNN---RIVGIVSFGSGEGCTAGR-PAGFTRVTGYLDW 262
            ..:.:|...||..|||:|||||||....:|   ::.|||||||..||...| |:.||||:.|:||
Mouse   199 KSSMVCAGGDGVTSSCNGDSGGPLNCRASNGQWQVHGIVSFGSSLGCNYPRKPSVFTRVSNYIDW 263

  Fly   263 I 263
            |
Mouse   264 I 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon44ENP_001286203.1 Tryp_SPc 40..263 CDD:214473 82/256 (32%)
Tryp_SPc 41..266 CDD:238113 84/257 (33%)
Cela2aNP_031945.1 Tryp_SPc 30..264 CDD:214473 77/240 (32%)
Tryp_SPc 31..267 CDD:238113 79/241 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 147 1.000 Inparanoid score I4390
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.