DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon44E and CG43336

DIOPT Version :9

Sequence 1:NP_001286203.1 Gene:Jon44E / 35853 FlyBaseID:FBgn0001285 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001247122.1 Gene:CG43336 / 12798414 FlyBaseID:FBgn0263041 Length:279 Species:Drosophila melanogaster


Alignment Length:292 Identity:80/292 - (27%)
Similarity:117/292 - (40%) Gaps:73/292 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FVFLACLAVASAGVVPSESARAVPVKDMPRAGKIEGRITNGYPAYEGKIPYIVGLSFNDGGYWCG 68
            |:.:||...|.:..||                    |:.||..|.....|::..|...||.:.||
  Fly    21 FLDMACGIRAHSPSVP--------------------RVKNGTVASLTSSPWMAFLHSTDGRFICG 65

  Fly    69 GSIIDHTWVLTAAHCTNSANHVLIYFGASFRHEAQYTH----------WVSRSDMIQHPDWNDF- 122
            ||:|.:..|||||||......::...|...|.|.:..|          .|.|.  .:|..:|.. 
  Fly    66 GSLITNRLVLTAAHCFLDRTELVARLGEYDREEYEMCHDSYCTYRIEAMVERG--FRHRHYNPMT 128

  Fly   123 LNNDIALIRIPHVDFWSLVNKVELP---------------SYNDRYNSYSGWWAVASGWGLTDNN 172
            :..|||::|        |..||:..               .|.|..:..:|     :|||.|: :
  Fly   129 MAYDIAILR--------LYRKVQYTDNIRPICIVIDPRWRKYIDSLDPLTG-----TGWGKTE-S 179

  Fly   173 SGMSNYLNCVDVQIIDNNDCRNYYGSNYITDNTICINTDGGKSSCSGDSGGP---LVLHDNNR-- 232
            .|.|..|..||:.......||. |.:..:|.|..|...: ..:.|:||||||   |:.:..::  
  Fly   180 EGDSAKLRTVDLARKHPEVCRR-YATLSLTANQFCAGNE-RSNLCNGDSGGPVGALIPYGKSKRF 242

  Fly   233 -IVGIVSFGSGEGCTAGRPAGFTRVTGYLDWI 263
             .|||.||.:.: |.  ..:.||.|..|:|||
  Fly   243 VQVGIASFTNTQ-CV--MVSVFTDVMSYVDWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon44ENP_001286203.1 Tryp_SPc 40..263 CDD:214473 72/254 (28%)
Tryp_SPc 41..266 CDD:238113 73/255 (29%)
CG43336NP_001247122.1 Tryp_SPc 37..271 CDD:214473 72/254 (28%)
Tryp_SPc 40..271 CDD:238113 71/251 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435673
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24260
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.