DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon44E and Ctrl

DIOPT Version :9

Sequence 1:NP_001286203.1 Gene:Jon44E / 35853 FlyBaseID:FBgn0001285 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_075671.1 Gene:Ctrl / 109660 MGIID:88558 Length:264 Species:Mus musculus


Alignment Length:233 Identity:88/233 - (37%)
Similarity:124/233 - (53%) Gaps:17/233 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 RITNGYPAYEGKIPYIVGLSFNDGGYWCGGSIIDHTWVLTAAHCTNSANHVLIYFGASFR-HEAQ 103
            ||.||..|..|..|:.|.|..|.|.::||||:|...||:|||||..:.....:..|...| ..|:
Mouse    33 RIVNGENAVPGSWPWQVSLQDNTGFHFCGGSLISPNWVVTAAHCQVTPGRHFVVLGEYDRSSNAE 97

  Fly   104 YTHWVSRSDMIQHPDWN-DFLNNDIALIRIPH-VDFWSLVNKVELPSYNDRYNSYSGWWAVASGW 166
            ....:|.:..|.||:|| :.:|||:.|:::.. ..:.:.|:.|.|.|.|:...  ||...|.:||
Mouse    98 PVQVLSIARAITHPNWNANTMNNDLTLLKLASPARYTAQVSPVCLASTNEALP--SGLTCVTTGW 160

  Fly   167 GLTDNNSGMSNY----LNCVDVQIIDNNDCRNYYGSNYITDNTICINTDGGKSSCSGDSGGPLVL 227
            |   ..||:.|.    |..|.:.::..|.||.|:|:. |||..||.. ..|.|||.||||||||.
Mouse   161 G---RISGVGNVTPARLQQVVLPLVTVNQCRQYWGAR-ITDAMICAG-GSGASSCQGDSGGPLVC 220

  Fly   228 HDNNR--IVGIVSFGSGEGCTAGRPAGFTRVTGYLDWI 263
            ...|.  ::||||:|: :.|....||.:|||:.:..||
Mouse   221 QKGNTWVLIGIVSWGT-KNCNIQAPAMYTRVSKFSTWI 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon44ENP_001286203.1 Tryp_SPc 40..263 CDD:214473 86/231 (37%)
Tryp_SPc 41..266 CDD:238113 87/232 (38%)
CtrlNP_075671.1 Tryp_SPc 33..257 CDD:214473 86/231 (37%)
Tryp_SPc 34..260 CDD:238113 87/232 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 147 1.000 Inparanoid score I4390
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1522379at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.970

Return to query results.
Submit another query.