DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon44E and cela1.2

DIOPT Version :9

Sequence 1:NP_001286203.1 Gene:Jon44E / 35853 FlyBaseID:FBgn0001285 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001307331.1 Gene:cela1.2 / 100535584 ZFINID:ZDB-GENE-050208-732 Length:269 Species:Danio rerio


Alignment Length:283 Identity:92/283 - (32%)
Similarity:136/283 - (48%) Gaps:48/283 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LFVFLACLAVASAGVVPSESARAVPVKDMPRAGKIEGRITNGYPAYEGKIPYIVGLSFNDGG--- 64
            |...||.||:|....          :||:    .||.|:..|..|.....|:.:.|.::|.|   
Zfish     6 LLSVLATLALAEPRY----------LKDI----AIEERVVGGEIAKPHSWPWQISLQYSDLGTYY 56

  Fly    65 YWCGGSIIDHTWVLTAAHCTNSANHVLIYFGASFRHEAQYTH-----WVSRSDMIQHPDWNDFLN 124
            |:|.|::|...||:.||||..:.....:..|   .|:. |||     ::|.|::..||:||.  |
Zfish    57 YYCSGTLIRPGWVMVAAHCVEALRKWTVALG---DHDI-YTHEGPEQYISVSEVFIHPNWNP--N 115

  Fly   125 N-----DIALIRIPHVD--FWSLVNKVELPSYND--RYNSYSGWWAVASGWGLTDNNSGMSNYLN 180
            |     ||||:|: .:|  ..|.|....|||..:  .|    |.....:|||.|:....:|..|.
Zfish   116 NVAFGYDIALLRL-SIDATLSSYVQVATLPSSGEILPY----GHTCYITGWGYTETGGSLSAQLK 175

  Fly   181 CVDVQIIDNNDC--RNYYGSNYITDNTICINTDGGKSSCSGDSGGPLVLHDNNRIV--GIVSFGS 241
            ...:.::|...|  ::::||: :.:..||.......|:|.||||.||....|.:.|  |:.||.|
Zfish   176 QAYMPVVDYETCSQKDWWGSS-VKETMICAGGTTSMSACHGDSGSPLNCLFNGKYVVHGVTSFVS 239

  Fly   242 GEGC-TAGRPAGFTRVTGYLDWI 263
            .||| |..:|.|||||:.|::||
Zfish   240 PEGCNTYKKPTGFTRVSAYINWI 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon44ENP_001286203.1 Tryp_SPc 40..263 CDD:214473 80/244 (33%)
Tryp_SPc 41..266 CDD:238113 81/245 (33%)
cela1.2NP_001307331.1 Tryp_SPc 29..262 CDD:214473 80/244 (33%)
Tryp_SPc 30..265 CDD:238113 81/245 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 154 1.000 Domainoid score I4208
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 156 1.000 Inparanoid score I4253
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D434399at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm24991
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.970

Return to query results.
Submit another query.