DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon44E and Tpsab1

DIOPT Version :9

Sequence 1:NP_001286203.1 Gene:Jon44E / 35853 FlyBaseID:FBgn0001285 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_112464.4 Gene:Tpsab1 / 100503895 MGIID:96943 Length:273 Species:Mus musculus


Alignment Length:269 Identity:96/269 - (35%)
Similarity:130/269 - (48%) Gaps:35/269 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 SESARAVPVKDMPRAGKIEGRITNGYPAYEGKIPYIVGLSFNDGGYW---CGGSIIDHTWVLTAA 81
            |....|.|...|.|.|     |..|..|:..|.|:.|.|..|| .||   ||||:|...||||||
Mouse    13 SSLVHAAPGPAMTREG-----IVGGQEAHGNKWPWQVSLRAND-TYWMHFCGGSLIHPQWVLTAA 71

  Fly    82 HCTN----SANHVLIYFGASFRHEAQYTHWVSRSDMIQHPDWNDFLNN-DIALIRIPH-VDFWSL 140
            ||..    ..|.|.:.....:.:  .:.|.::.|.:|.|||:....:. ||||:::.: |:....
Mouse    72 HCVGPDVADPNKVRVQLRKQYLY--YHDHLMTVSQIITHPDFYIVQDGADIALLKLTNPVNISDY 134

  Fly   141 VNKVELPSYNDRYNSYSGWWAVASGWGLTDNNSGMSN--YLNCVDVQIIDNNDCRNYYGSNYIT- 202
            |:.|.||..::.:.|.:..|  .:|||..||...:..  .|..|.|.||:|:.|...|....|| 
Mouse   135 VHPVPLPPASETFPSGTLCW--VTGWGNIDNGVNLPPPFPLKEVQVPIIENHLCDLKYHKGLITG 197

  Fly   203 -------DNTICINTDGGKSSCSGDSGGPLV--LHDNNRIVGIVSFGSGEGCT-AGRPAGFTRVT 257
                   |:.:|...: |..||.||||||||  :.|.....|:||:  ||||. ..||..:||||
Mouse   198 DNVHIVRDDMLCAGNE-GHDSCQGDSGGPLVCKVEDTWLQAGVVSW--GEGCAQPNRPGIYTRVT 259

  Fly   258 GYLDWIRDH 266
            .|||||..:
Mouse   260 YYLDWIHHY 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon44ENP_001286203.1 Tryp_SPc 40..263 CDD:214473 88/244 (36%)
Tryp_SPc 41..266 CDD:238113 90/246 (37%)
Tpsab1NP_112464.4 Tryp_SPc 29..266 CDD:238113 89/244 (36%)
Tryp_SPc 29..265 CDD:214473 88/243 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X11
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.