DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Jon44E and f7l

DIOPT Version :9

Sequence 1:NP_001286203.1 Gene:Jon44E / 35853 FlyBaseID:FBgn0001285 Length:271 Species:Drosophila melanogaster
Sequence 2:NP_001083027.2 Gene:f7l / 100038778 ZFINID:ZDB-GENE-070424-102 Length:431 Species:Danio rerio


Alignment Length:259 Identity:82/259 - (31%)
Similarity:127/259 - (49%) Gaps:19/259 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 SESARAVPVKDM----PRAGKIEGRITNGYPAYEGKIPYIVGLSFNDGGYWCGGSIIDHTWVLTA 80
            |:::..||..|.    |.|..:..||..|....:|:.|:...|.: ||.|.|||.|::..|::||
Zfish   170 SDNSSCVPTADFSCGRPVAKGVGPRIVKGDVCPKGQCPWQALLEY-DGQYKCGGVILNSQWIITA 233

  Fly    81 AHCTNSANHVL--IYFGASFRHEAQYTHWVSR-SDMIQHPDWN-DFLNNDIALIRIPH-VDFWSL 140
            |||....:..|  :..|...|...:.|..:.: |::..||.:| ...::|:||:|:.. |.....
Zfish   234 AHCIWRKDPALLQVIVGEHIRDRDEGTEQMRKVSEVFLHPQYNHSSTDSDVALLRLHRPVTLGPY 298

  Fly   141 VNKVELPSYNDRYNS--YSGWWAVASGWGLTDNNSGMSNYLNCVDVQIIDNNDCRNYYGSNYITD 203
            ...|.||..|..::.  .|...:..||||....:...|..|..:.|..:.:.|||...|.. ::.
Zfish   299 ALPVCLPPPNGTFSRTLASIRMSTVSGWGRLAQSGPPSTVLQRLQVPRVSSEDCRARSGLT-VSR 362

  Fly   204 NTICIN-TDGGKSSCSGDSGGPLVLHDNNR--IVGIVSFGSGEGCTAGRPAG-FTRVTGYLDWI 263
            |.:|.. .:||:.||.||||||||....|.  :.||||:  |:||......| :|||:.:::||
Zfish   363 NMLCAGFAEGGRDSCQGDSGGPLVTRYRNTWFLTGIVSW--GKGCARADVYGIYTRVSVFVEWI 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Jon44ENP_001286203.1 Tryp_SPc 40..263 CDD:214473 74/233 (32%)
Tryp_SPc 41..266 CDD:238113 75/234 (32%)
f7lNP_001083027.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.