DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beta3GalTII and B3galnt2

DIOPT Version :9

Sequence 1:NP_610399.1 Gene:beta3GalTII / 35848 FlyBaseID:FBgn0033315 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001349333.1 Gene:B3galnt2 / 97884 MGIID:2145517 Length:504 Species:Mus musculus


Alignment Length:186 Identity:57/186 - (30%)
Similarity:94/186 - (50%) Gaps:25/186 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 RTKRLITVKHVFSIGTLDLSSSALAELEKEQNQNNDLLLLNRHHDTYKNLTAKLMQSLYILRRHY 194
            |.:||  ..|:..:...|      |.|::|.:.::|::.:: ..|||:|:.|||:..........
Mouse   294 RPQRL--ADHIQDLQVED------ALLQEESSVHDDIVFVD-VVDTYRNVPAKLLNFYRWTVEST 349

  Fly   195 EFSYMLKVDDDTYVKLDSLVNTLVSYDRKLLRKRSEYRDHVLPQLYWGYFNGRSTIKTKGQWKES 259
            .|..:||.|||.|:.|:::.|       ::.:|..:.     |..:||.|.....:...|:|:|.
Mouse   350 SFDLLLKTDDDCYIDLEAVFN-------RIAQKNLDG-----PNFWWGNFRLNWAVDRTGKWQEL 402

  Fly   260 SYYLSKNYLPYALGGGYVLSRSLCDYIVNNSQLLSHYGSEDVSVGTWLA---PLRH 312
            . |.|..|..:|.|.|||:|:.:.|::..||:.|..|..||||:|.|:|   |.||
Mouse   403 E-YPSPAYPAFACGSGYVISKDIVDWLAGNSRRLKTYQGEDVSMGIWMAAIGPKRH 457

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beta3GalTIINP_610399.1 Galactosyl_T 125..319 CDD:304462 57/186 (31%)
B3galnt2NP_001349333.1 Galactosyl_T <330..459 CDD:328824 47/141 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D640360at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.