DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beta3GalTII and AT1G77810

DIOPT Version :9

Sequence 1:NP_610399.1 Gene:beta3GalTII / 35848 FlyBaseID:FBgn0033315 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001319398.1 Gene:AT1G77810 / 844443 AraportID:AT1G77810 Length:387 Species:Arabidopsis thaliana


Alignment Length:361 Identity:84/361 - (23%)
Similarity:140/361 - (38%) Gaps:102/361 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LTKILSSVDQCPAHRSRIPHLEPHP--NLFLMVLVLSAPHNADERNAMRRTWLANAGQSIAQPYL 85
            |.|.:|::....:.:..:...|.:|  .:|:::.:.:|..:...|:::|.||:            
plant    90 LDKSVSTLSSTRSSQEMVDGSETNPRKKVFMVMGINTAFSSRKRRDSVRETWM------------ 142

  Fly    86 PEELIYLPTFNAQGHLQVELVAEQASRLRQYTNWQQSLLTEGPPRTKRLITVKHVFSIGTLDLSS 150
                       .||        |:..||.|                ::.|.:|  |.||....|:
plant   143 -----------PQG--------EKLERLEQ----------------EKGIVIK--FMIGHSATSN 170

  Fly   151 SAL-AELEKEQNQNNDLLLLNRHHDTYKNLTAKLMQSLYILRRHYEFSYMLKVDDDTYVKLDSLV 214
            |.| ..::.|..|:.|.|.| .|.:.|..|:||...........::..:.:|||||.:|.|..|.
plant   171 SILDRAIDSEDAQHKDFLRL-EHVEGYHELSAKTKIFFSTAVAKWDAEFYIKVDDDVHVNLGMLA 234

  Fly   215 NTLVSYDRKLLRKRSEYRDHVLPQLYWGYFNGRSTIKTKG-QWKESSYYL----SKNYLPYALGG 274
            :||.       |.||:      |::|.|.......:..|. ::.|..|:.    ...|..:|.|.
plant   235 STLA-------RHRSK------PRVYIGCMKSGPVLAQKTVKYHEPEYWKFGEDGNKYFRHATGQ 286

  Fly   275 GYVLSRSLCDYIVNNSQLLSHYGSEDVSVGTWLAPL--RHV------------YRWHDPRFDTSY 325
            .|.:|:.|.:||..|..:|..|.:||||:|:|...|  .|:            .||.....|...
plant   287 IYAISKDLANYISINQPILHKYANEDVSLGSWFIGLEVEHIDDRNFCCGTPPDCRWKAEAGDVCV 351

  Fly   326 APRK------CRSYHMVLHKRNGQMMRDIHDGELCS 355
            |..:      |:|.         :.|:.:|  |:||
plant   352 ASFEWSCSGICKSV---------ERMKIVH--EVCS 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beta3GalTIINP_610399.1 Galactosyl_T 125..319 CDD:304462 58/213 (27%)
AT1G77810NP_001319398.1 PLN03193 6..384 CDD:178735 84/361 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 73 1.000 Domainoid score I3262
eggNOG 1 0.900 - - E1_KOG2288
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D640360at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.780

Return to query results.
Submit another query.