DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beta3GalTII and AT1G53290

DIOPT Version :9

Sequence 1:NP_610399.1 Gene:beta3GalTII / 35848 FlyBaseID:FBgn0033315 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_175736.2 Gene:AT1G53290 / 841763 AraportID:AT1G53290 Length:345 Species:Arabidopsis thaliana


Alignment Length:313 Identity:70/313 - (22%)
Similarity:122/313 - (38%) Gaps:93/313 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 NADERNAMRRTWLANAGQSIAQPYLPEELIYLPTFNAQGHLQVELVAEQASRLRQYTNWQQSLLT 125
            :|..|.::|:||:         |..||.|                     .||.:.|.       
plant    98 SAGRRRSLRKTWM---------PSDPEGL---------------------RRLEESTG------- 125

  Fly   126 EGPPRTKRLITVKHVFSIGTLDLSSSALAELEKEQNQNNDLLLLNRHHDTYKNL---TAKLMQSL 187
                     :.::  |.||... |...:|:|.:|..:.:|.:||:...: |..|   |....::.
plant   126 ---------LAIR--FMIGKTK-SEEKMAQLRREIAEYDDFVLLDIEEE-YSKLPYKTLAFFKAA 177

  Fly   188 YILRRHYEFSYMLKVDDDTYVKLDSLVNTLVSYDRK-------LLRKRSEYRDHVLPQLYWGYFN 245
            |.|   |:..:.:|.|||.|::.|.| :.|::.:|.       .|:|...:.|   |:|.|    
plant   178 YAL---YDSEFYVKADDDIYLRPDRL-SLLLAKERSHSQTYLGCLKKGPVFTD---PKLKW---- 231

  Fly   246 GRSTIKTKGQWKESSYYLSKNYLPYALGGGYVLSRSLCDYIV---NNSQLLSHYGSEDVSVGTWL 307
                      ::..|:.|.|.|..:|.|..|.||..:...:|   |||  ...:.:|||::|.|:
plant   232 ----------YEPLSHLLGKEYFLHAYGPIYALSADVVASLVALKNNS--FRMFNNEDVTIGAWM 284

  Fly   308 APLRHVYRWHDPRFDTSYAPRKCRSYHMVLHKRNG-----QMMRDIHDGELCS 355
            ..:...:..|....:...:|.....:.  :.|.:|     :.|.::|..|.||
plant   285 LAMNVNHENHHILCEPECSPSSVAVWD--IPKCSGLCNPEKRMLELHKQESCS 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beta3GalTIINP_610399.1 Galactosyl_T 125..319 CDD:304462 50/206 (24%)
AT1G53290NP_175736.2 Galactosyl_T 101..293 CDD:419759 60/264 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 73 1.000 Domainoid score I3262
eggNOG 1 0.900 - - E1_KOG2288
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D640360at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.780

Return to query results.
Submit another query.