DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beta3GalTII and AT1G05170

DIOPT Version :9

Sequence 1:NP_610399.1 Gene:beta3GalTII / 35848 FlyBaseID:FBgn0033315 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001077462.1 Gene:AT1G05170 / 839292 AraportID:AT1G05170 Length:407 Species:Arabidopsis thaliana


Alignment Length:348 Identity:75/348 - (21%)
Similarity:124/348 - (35%) Gaps:120/348 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 FLMVL-VLSAPHNADERNAMRRTWLANAGQSIAQPYLPEELIYLPTFNAQGHLQVELVAEQASRL 113
            ||||: :.:|..:...|:::|.||:                       .||..:..|..|:...:
plant   138 FLMVVGINTAFSSRKRRDSIRATWM-----------------------PQGEKRKRLEEEKGIII 179

  Fly   114 RQYTNWQQSLLTEGPPRTKRLITVKHVFSI-GTLDLSSSALAELEKEQNQNNDLLLLNRHHDTYK 177
            |                    ..:.|..:. |.||.:      :|.|..::.|.|.|: |.:.|.
plant   180 R--------------------FVIGHSATTGGILDRA------IEAEDRKHGDFLRLD-HVEGYL 217

  Fly   178 NLTAKLMQSLYILRRHYEFSYMLKVDDDTYVKLDSLVNTLVSYDRKLLRKRSEYRDHVLPQLYWG 242
            .|:.|...........::..:.:|||||.:|.:.:|..|||.:.:|             |::|.|
plant   218 ELSGKTKTYFSTAFSMWDADFYVKVDDDVHVNIATLGETLVRHRKK-------------PRVYIG 269

  Fly   243 YFNGRSTIKTKG-QWKESSYYL----SKNYLPYALGGGYVLSRSLCDYIVNNSQLLSHYGSEDVS 302
            .......:..|| ::.|..|:.    ...|..:|.|..|.:||.|..||..|..:|..|.:||||
plant   270 CMKSGPVLSQKGVRYHEPEYWKFGENGNKYFRHATGQLYAISRDLASYISINQHVLHKYANEDVS 334

  Fly   303 VGTWLAPLRHVYRWHDPRFDTSYAPRKCRSYHMVLHKRNGQMMRDIHDGELCSG----------I 357
            :|.|..                                 |..::.|.|..||.|          .
plant   335 LGAWFI---------------------------------GIDVKHIDDRRLCCGTPPDCEWKAQA 366

  Fly   358 GSSILSDYYYDWT-----RTADK 375
            |:..::.  :||:     |:||:
plant   367 GNICVAS--FDWSCSGICRSADR 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beta3GalTIINP_610399.1 Galactosyl_T 125..319 CDD:304462 49/199 (25%)
AT1G05170NP_001077462.1 PLN03193 1..407 CDD:178735 75/348 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 73 1.000 Domainoid score I3262
eggNOG 1 0.900 - - E1_KOG2288
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D640360at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
76.780

Return to query results.
Submit another query.