DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beta3GalTII and AT1G11730

DIOPT Version :9

Sequence 1:NP_610399.1 Gene:beta3GalTII / 35848 FlyBaseID:FBgn0033315 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_172638.1 Gene:AT1G11730 / 837717 AraportID:AT1G11730 Length:384 Species:Arabidopsis thaliana


Alignment Length:415 Identity:96/415 - (23%)
Similarity:157/415 - (37%) Gaps:123/415 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 NLVT----FFTAITAFFFGSFLTKILSSVDQCPAHR--SRIPHLEPHPNLFLMVLVLSAPHNADE 64
            |:|:    ||..:.:|..|.|.|..:.::  .|..|  ||:..|.           ||: .:.|:
plant    15 NVVSRNSVFFMCLASFCLGMFFTNRMWNI--VPEARGISRLSKLS-----------LSS-SDCDK 65

  Fly    65 RNAM--RRTWLANAGQSIAQPYLPEELIYLPTFNAQGHLQVELVAEQASR--------------L 113
            :|.:  ....:....:||:                  :|:::|||.:|.|              .
plant    66 KNVLDYGNNTIGILDKSIS------------------NLEMKLVAARAERESLSGKFNISNEAKK 112

  Fly   114 RQY--------------------TNWQQSLLTEGPPRTKRLITVKHV---FSIGTLDLSSSALAE 155
            |:|                    :.|    :.:| ...|:|...|.:   |.||...||...|.:
plant   113 RKYFMVIGINTAFSSRKRRDSVRSTW----MPQG-ENLKKLEEEKGIIVRFVIGHSVLSHGILDK 172

  Fly   156 -LEKEQNQNNDLLLLNRHHDTYKNLTAKLMQSLYILRRHYEFSYMLKVDDDTYVKLDSLVNTLVS 219
             :|.|:..:.|.|.| .|.:.|..|:||...........::..:.:|||||.:|.|.||...|.:
plant   173 AIEAEEKTHGDFLRL-EHTEGYMKLSAKTKTFFATAVSLWDAEFYIKVDDDVHVNLASLKKALSA 236

  Fly   220 YDRKLLRKRSEYRDHVLPQLYWGYFNGRSTIKTKG-QWKESSYY----LSKNYLPYALGGGYVLS 279
            :..|             |::|.|.......:..|. ::.|..|:    :...|..:|.|..|.:|
plant   237 HQNK-------------PRVYVGCMKSGPVLARKSVKYHEPEYWKFGEVGNKYFRHATGQFYAIS 288

  Fly   280 RSLCDYIVNNSQLLSHYGSEDVSVGTWLAPL--RHVYRWHDPRFDTSYAPRKCRSYHMVLHK--- 339
            :.|..||:.|..||..|.:||||:|:|...|  .||    |.:.......:.|....|:.|.   
plant   289 KDLATYILINQDLLHKYANEDVSLGSWFIGLNVEHV----DEKRLCCSTSQDCELKAMMGHVCAA 349

  Fly   340 ----------RNGQMMRDIHD--GE 352
                      |:.:.|.|:|:  ||
plant   350 SFDWKCSGICRSAERMADVHERCGE 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beta3GalTIINP_610399.1 Galactosyl_T 125..319 CDD:304462 58/204 (28%)
AT1G11730NP_172638.1 PLN03193 1..382 CDD:178735 96/415 (23%)
DUF4094 18..96 CDD:290073 21/109 (19%)
Galactosyl_T 129..325 CDD:304462 59/218 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 73 1.000 Domainoid score I3262
eggNOG 1 0.900 - - E1_KOG2288
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D640360at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_107698
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.680

Return to query results.
Submit another query.