DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beta3GalTII and AT5G62620

DIOPT Version :9

Sequence 1:NP_610399.1 Gene:beta3GalTII / 35848 FlyBaseID:FBgn0033315 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_201068.1 Gene:AT5G62620 / 836383 AraportID:AT5G62620 Length:681 Species:Arabidopsis thaliana


Alignment Length:345 Identity:75/345 - (21%)
Similarity:129/345 - (37%) Gaps:76/345 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 NLFLMVLVLSAPHNADERN-AMRRTWLANAGQSIAQPYLPEELI--YLPTFNAQGHLQVELVAEQ 109
            ::|...|..|.|..:.:|: .:...|.|        |.||:|.:  ::...:|..|.        
plant   397 SVFAGSLPTSHPSFSPQRHLELSSNWQA--------PSLPDEQVDMFIGILSAGNHF-------- 445

  Fly   110 ASRLRQYTNWQQSLLTEGPPRTKRLITVKHVFSIGTLDLSSSALAELEKEQNQNNDLLLLNRHHD 174
            |.|:....:|.|..|.:......|.....|        .......||:||.....|:::: .:.|
plant   446 AERMAVRRSWMQHKLVKSSKVVARFFVALH--------SRKEVNVELKKEAEFFGDIVIV-PYMD 501

  Fly   175 TYKNLTAKLMQSLYILRRHYEFSYMLKVDDDTYVKLDSLVNTL--VSYDRKLLRKRSEYRDHVLP 237
            :|..:..|.:.............:::|.||||:|::|::::..  ...||.|......|....|.
plant   502 SYDLVVLKTVAICEYGAHQLAAKFIMKCDDDTFVQVDAVLSEAKKTPTDRSLYIGNINYYHKPLR 566

  Fly   238 QLYWGYFNGRSTIKTKGQWKESSYYLSKNYLPYALGGGYVLSRSLCDYIVN--NSQLLSHYGSED 300
            |..|..        |..:|.|      ::|.|||.|.||:||..:..:||.  ....|..:..||
plant   567 QGKWSV--------TYEEWPE------EDYPPYANGPGYILSNDISRFIVKEFEKHKLRMFKMED 617

  Fly   301 VSVGTWL-------APLRHVYRWHDPRFDTSYAPRKCRSYHMVLHKRNGQMMRDIHDGELCSGIG 358
            ||||.|:       .|:.::   |..||    ....|...::..|.::.:.|..:.|..:.:|  
plant   618 VSVGMWVEQFNNGTKPVDYI---HSLRF----CQFGCIENYLTAHYQSPRQMICLWDKLVLTG-- 673

  Fly   359 SSILSDYYYDWTRTADKCCD 378
                          ..:||:
plant   674 --------------KPQCCN 679

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beta3GalTIINP_610399.1 Galactosyl_T 125..319 CDD:304462 48/204 (24%)
AT5G62620NP_201068.1 PLN03133 126..681 CDD:215596 75/345 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11214
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.