DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beta3GalTII and AT4G32120

DIOPT Version :9

Sequence 1:NP_610399.1 Gene:beta3GalTII / 35848 FlyBaseID:FBgn0033315 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_194939.1 Gene:AT4G32120 / 829344 AraportID:AT4G32120 Length:345 Species:Arabidopsis thaliana


Alignment Length:179 Identity:44/179 - (24%)
Similarity:83/179 - (46%) Gaps:18/179 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 FSIG-TLDLSSSALAELEKEQNQNNDLLLLNRHHDTYKNLTAKLMQSLYILRRHYEFSYMLKVDD 204
            |.|| :.:...|...::::|.....|.|:|..|.:..:.|..|:........::::..:.:||||
plant   160 FVIGRSANRGDSLDRKIDEENRATKDFLILENHEEAQEELPKKVKFFYSAAVQNWDAEFYVKVDD 224

  Fly   205 DTYVKLDSLVNTLVSYDRKLLRKRSEYRDHVLPQLYWGYFNGRSTIKTKG-QWKESSYYL---SK 265
            :..:.|:.::..|.|       :||:      ...|.|.......|..:| ||.|..::.   .|
plant   225 NVDLDLEGMIALLES-------RRSQ------DGAYIGCMKSGDVITEEGSQWYEPEWWKFGDDK 276

  Fly   266 NYLPYALGGGYVLSRSLCDYIVNNSQLLSHYGSEDVSVGTWLAPLRHVY 314
            :|..:|.|...:||::|..|:..||.||..|..:|.::|:|:..::..|
plant   277 SYFRHATGSLVILSKNLAQYVNINSGLLKTYAFDDTTIGSWMIGVQATY 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beta3GalTIINP_610399.1 Galactosyl_T 125..319 CDD:304462 44/179 (25%)
AT4G32120NP_194939.1 DUF4094 24..102 CDD:290073
Galactosyl_T 134..328 CDD:304462 44/179 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 73 1.000 Domainoid score I3262
eggNOG 1 0.900 - - E1_KOG2288
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D640360at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.780

Return to query results.
Submit another query.