DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beta3GalTII and AT4G21060

DIOPT Version :9

Sequence 1:NP_610399.1 Gene:beta3GalTII / 35848 FlyBaseID:FBgn0033315 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_193838.2 Gene:AT4G21060 / 827853 AraportID:AT4G21060 Length:741 Species:Arabidopsis thaliana


Alignment Length:315 Identity:70/315 - (22%)
Similarity:118/315 - (37%) Gaps:105/315 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 LMVLVLSAPHNADERNAMRRTWLANAGQSIAQPYLPEELIYLPTFNAQGHLQVELVAEQASRLRQ 115
            |.:.||||.::..||.|:|:||:.:                                        
plant   495 LFMGVLSATNHFSERMAVRKTWMQH---------------------------------------- 519

  Fly   116 YTNWQQSLLTEGPPRTKRLITVKHVFSIGTLDLSSSALAELEKEQNQNNDLLLLNRHHDTYKNLT 180
                         |..|....|...|.  .|:......|.|:||.....|:::| ...|.|:.:.
plant   520 -------------PSIKSSDVVARFFV--ALNPRKEVNAMLKKEAEYFGDIVIL-PFMDRYELVV 568

  Fly   181 AKLMQSLYILRRHYEFSYMLKVDDDTYVKLDSLVNTLVSYDRKLLRKRSEYRDHVLPQ--LYWGY 243
            .|.:.......::....|::|.||||:::::|::..:               |.|.|:  ||.|.
plant   569 LKTIAICEFGVQNVTAPYIMKCDDDTFIRVESILKQI---------------DGVSPEKSLYMGN 618

  Fly   244 FN--------GRSTIKTKGQWKESSYYLSKNYLPYALGGGYVLSRSLCDYIV--NNSQLLSHYGS 298
            .|        |:.|: |..:|.|:.      |.|||.|.||::|.::..|||  |:...|..:..
plant   619 LNLRHRPLRTGKWTV-TWEEWPEAV------YPPYANGPGYIISSNIAKYIVSQNSRHKLRLFKM 676

  Fly   299 EDVSVGTW-------LAPLRHVYRWHDPRFDTSYAPRKCR-SYHMVLHKRNGQMM 345
            ||||:|.|       :.|:.:.:.|       .:....|. :|:...::...|||
plant   677 EDVSMGLWVEQFNASMQPVEYSHSW-------KFCQYGCTLNYYTAHYQSPSQMM 724

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beta3GalTIINP_610399.1 Galactosyl_T 125..319 CDD:304462 54/212 (25%)
AT4G21060NP_193838.2 Gal-bind_lectin 250..461 CDD:278752
Galactosyl_T 509..686 CDD:304462 57/254 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11214
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.