DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment beta3GalTII and CG11357

DIOPT Version :9

Sequence 1:NP_610399.1 Gene:beta3GalTII / 35848 FlyBaseID:FBgn0033315 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001097505.1 Gene:CG11357 / 38561 FlyBaseID:FBgn0035558 Length:434 Species:Drosophila melanogaster


Alignment Length:315 Identity:66/315 - (20%)
Similarity:114/315 - (36%) Gaps:87/315 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 QCPAHRSRIPHLEPHPN-LFL------------MVLVLSAPHNADERNAMRRTWLANAGQSIAQP 83
            |.|.......||...|| ::|            ::||.||..|.::|..:|.|| ||        
  Fly   104 QTPTPPQSSMHLMDLPNFVYLIDQPACDKDVRALILVHSAVRNIEKRRIIRETW-AN-------- 159

  Fly    84 YLPEELIYLPTFNAQGHLQVELVAEQASRLRQYTNWQQSLLTEGPPRTKRLITVKHVFSIGTLDL 148
                                                 :|.:.:.|        :|..|.:|.:..
  Fly   160 -------------------------------------RSYIDQTP--------LKVYFLVGGVSA 179

  Fly   149 SSSALAE-LEKEQNQNNDLLLLNRHHDTYKNLTAKLMQSL-YILRRHYEFSYMLKVDDDTYVKLD 211
            .|....: |.:|.:.:.||:..| ..|.|:|:|.|.:.:| :...:......::|||||.::...
  Fly   180 KSEKWQQFLGRENHLHGDLIQGN-FKDAYRNMTYKHVMALKWFNEKCAHAQLLVKVDDDVFMNTP 243

  Fly   212 SLVNTLVSYDRKLLRKRSEYRDHVLPQLYWGYFNGRSTIKT--KGQWKES-SYYLSKNYLPYALG 273
            .||..|.:   ..|.:.|..||   |.|........|.:|.  :.:|:.: ..|.::.|..|..|
  Fly   244 QLVKYLAT---PSLPEYSMLRD---PNLMLCRSVHHSRVKRSYRSKWRVTYKEYPNRFYPEYCPG 302

  Fly   274 GGYVLSRSLCDYIVNNSQLLSHYGSEDVSV--------GTWLAPLRHVYRWHDPR 320
            ...|.:..:...:...:|...::..:||.:        |:.:.||:|.....|.|
  Fly   303 MAIVYAPEVVRRLYEAAQKSKYFWVDDVLITGILAEETGSKITPLQHYLEQKDVR 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
beta3GalTIINP_610399.1 Galactosyl_T 125..319 CDD:304462 45/206 (22%)
CG11357NP_001097505.1 Galactosyl_T 148..347 CDD:304462 49/259 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11214
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.